Gene Information

Name : glr2416 (glr2416)
Accession : NP_925362.1
Strain : Gloeobacter violaceus PCC 7421
Genome accession: NC_005125
Putative virulence/resistance : Resistance
Product : aminoglycoside N6'-acetyltransferase
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG1670
EC number : -
Position : 2572897 - 2573418 bp
Length : 522 bp
Strand : +
Note : -

DNA sequence :
ATGTCGGGCTTAATTTCGATGACCTTCCGTCCGCTCGCACTGGCTGACCTGGTCTTGCTTCACGAGTGGCTGGCCCGTCC
GCATGTAGCCCAGTGGTGGGGACCGCCGCCCTCCGGTGCCGAAGTCGAGGAAGAGTATGGGCCGCTCCTTGACGGGACGG
GGCCGCATCGCGCTTACATCGCCCTTCAGGCGGGTATGCCCATCGGCTTTATCCAATCGTACACACCAGTGGCATGTCAT
GGGGAGGGGTGGTGGCTGGAGGAGCACGACGCAGGTGTACGCGGCATCGACCAGTTCCTCGCCCCTGCCGACCAGCTTGG
CCGGGGACTCGGTACCGCCATGGTCCTGGCCTTCGTGTCTGAGCTTCTGGCGGATCCGGGCGTCACGCGCATCCAGACCG
ACCCCTCCCCACAGAACCGCCGGGCCATTCGGTGCTACGAAAAAGCCGGCTTTCGGGCGGTCCGGGAGATCGACACGCCC
GACGGATGTGCCCTCCTGATGTACTACGATCGTCAAGTTTGA

Protein sequence :
MSGLISMTFRPLALADLVLLHEWLARPHVAQWWGPPPSGAEVEEEYGPLLDGTGPHRAYIALQAGMPIGFIQSYTPVACH
GEGWWLEEHDAGVRGIDQFLAPADQLGRGLGTAMVLAFVSELLADPGVTRIQTDPSPQNRRAIRCYEKAGFRAVREIDTP
DGCALLMYYDRQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aacA4 CAB46687.2 aminoglucoside acetyl-transferase Not tested Not named Protein 2e-33 54
aacA4 ACY75533.1 aminoglycoside acetyl transferase Not tested Tn6060 Protein 2e-34 54
aacA4 ADZ05804.1 aminoglycoside 6'-N-acetyltransferase Not tested AbaR3 Protein 7e-35 54
aacA4 AET25388.1 aminoglycoside 6'-N-acetyl transferase type Ib Not tested PAGI-2(C) Protein 7e-35 54
aacA4 AFG30111.1 aminoglycoside 6'-N-acetyl transferase type Ib Not tested PAGI-2 Protein 7e-35 54
aacA4 YP_005797131.1 aminoglycoside 6'-N-acetyl transferase Not tested AbaR4e Protein 3e-36 53
ACICU_00223 YP_001844882.1 aminoglycoside 6'-N-acetyl transferase type Ib Not tested AbaR20 Protein 3e-36 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF024602.1.gene2.p01 Protein 8e-34 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase Y18050.2.gene4.p01 Protein 8e-34 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY033653.3.gene5.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY123251.gene1.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF322577.2.gene3.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase GQ202693.1.gene3.p01 Protein 3e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF315351.1.gene3.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF317511.1.gene4.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY033653.3.gene4.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY162283.2.gene2.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF371964.1.gene2.p1 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase EF118171.1.gene3.p01 Protein 3e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF317511.1.gene3.p01 Protein 7e-35 54
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase EF636461.1.orf1.gene Protein 3e-33 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase EF375620.1.orf0.gene Protein 3e-33 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase HQ111474.1.gene2.p01 Protein 2e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AM412777.1.gene2.p01 Protein 5e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF318077.1.gene1.p01 Protein 2e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase FJ854362.1.gene3.p01 Protein 2e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase FJ848783.1.gene2.p01 Protein 5e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AJ584652.2.gene6.p01 Protein 5e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY007784.1.gene2.p01 Protein 2e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase FJ790516.1.gene2.p01 Protein 2e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AF231133.1.gene2.p01 Protein 5e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY103455.gene.p01 Protein 3e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase U59183.1.gene2.p01 Protein 1e-36 53
glr2416 NP_925362.1 aminoglycoside N6'-acetyltransferase AY123251.gene5.p01 Protein 2e-35 50