|
Name : emrE (CV_2680) Accession : NP_902350.1 Strain : Chromobacterium violaceum ATCC 12472 Genome accession: NC_005085 Putative virulence/resistance : Resistance Product : quaternary ammonium compound resistance protein / ethidium bromide resistant protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2903547 - 2903879 bp Length : 333 bp Strand : - Note : identified by sequence similarity; ORF located using Glimmer/GeneMark/Blastx/COG2076/TC:2.A.7.1.3 DNA sequence : ATGAAAGTCTGGCTGTTCCTGATGGGGGCCATCCTGTCCGAAGTGGTGGCCACCTCCGCGCTGAAGGCCTCCGACGGTTT TACCCGGCTGTGGCCGTCGTTGTTGACCGCCGGCGGCTACGTGCTGGCCTTCTACCTGTTGTCCCAGACACTGCGCCACA TTCCGGTGGGCATCGCCTACGCGCTGTGGTCGGGCATCGGCATCGTGTTGGTGTCGCTGATCGCCTGGCTGCTGTACGGC CAGAAGCTGGATCTGGCTGCGGTGGCGGGCATGGGCTTGATCATCGCCGGCGTGGCGGTGATCAATCTGTTTTCGCATAG CGCCGCGCACTGA Protein sequence : MKVWLFLMGAILSEVVATSALKASDGFTRLWPSLLTAGGYVLAFYLLSQTLRHIPVGIAYALWSGIGIVLVSLIAWLLYG QKLDLAAVAGMGLIIAGVAVINLFSHSAAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-21 | 62 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 1e-21 | 62 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 1e-21 | 62 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 1e-21 | 62 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-21 | 62 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-21 | 62 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 2e-21 | 62 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-21 | 62 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-21 | 62 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 1e-21 | 62 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-21 | 62 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 1e-21 | 62 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-21 | 62 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 2e-21 | 62 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 1e-21 | 62 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-21 | 62 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 2e-21 | 62 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-21 | 62 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-21 | 62 |
| unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 4e-18 | 46 |
| unnamed | CAD42068.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-14 | 44 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0324 | Protein | 2e-26 | 63 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0323 | Protein | 5e-22 | 62 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | NC_002695.1.913273.p | Protein | 8e-25 | 60 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0322 | Protein | 1e-25 | 60 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | NC_010410.6003348.p0 | Protein | 2e-24 | 60 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0002 | Protein | 2e-24 | 60 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | CP001138.1.gene1489. | Protein | 3e-23 | 60 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0377 | Protein | 3e-22 | 59 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | CP004022.1.gene1549. | Protein | 3e-23 | 59 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0150 | Protein | 1e-24 | 58 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0140 | Protein | 3e-15 | 45 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0249 | Protein | 2e-12 | 45 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | AE000516.2.gene3301. | Protein | 2e-12 | 45 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0329 | Protein | 1e-15 | 45 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0139 | Protein | 5e-13 | 44 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0477 | Protein | 5e-09 | 41 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0216 | Protein | 2e-07 | 41 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | BAC0192 | Protein | 1e-14 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | VFG1586 | Protein | 2e-18 | 46 |
| emrE | NP_902350.1 | quaternary ammonium compound resistance protein / ethidium bromide resistant protein | VFG1587 | Protein | 1e-14 | 44 |
