Gene Information

Name : emrE (CV_2680)
Accession : NP_902350.1
Strain : Chromobacterium violaceum ATCC 12472
Genome accession: NC_005085
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound resistance protein / ethidium bromide resistant protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2903547 - 2903879 bp
Length : 333 bp
Strand : -
Note : identified by sequence similarity; ORF located using Glimmer/GeneMark/Blastx/COG2076/TC:2.A.7.1.3

DNA sequence :
ATGAAAGTCTGGCTGTTCCTGATGGGGGCCATCCTGTCCGAAGTGGTGGCCACCTCCGCGCTGAAGGCCTCCGACGGTTT
TACCCGGCTGTGGCCGTCGTTGTTGACCGCCGGCGGCTACGTGCTGGCCTTCTACCTGTTGTCCCAGACACTGCGCCACA
TTCCGGTGGGCATCGCCTACGCGCTGTGGTCGGGCATCGGCATCGTGTTGGTGTCGCTGATCGCCTGGCTGCTGTACGGC
CAGAAGCTGGATCTGGCTGCGGTGGCGGGCATGGGCTTGATCATCGCCGGCGTGGCGGTGATCAATCTGTTTTCGCATAG
CGCCGCGCACTGA

Protein sequence :
MKVWLFLMGAILSEVVATSALKASDGFTRLWPSLLTAGGYVLAFYLLSQTLRHIPVGIAYALWSGIGIVLVSLIAWLLYG
QKLDLAAVAGMGLIIAGVAVINLFSHSAAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-21 62
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-21 62
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-21 62
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-21 62
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-21 62
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-21 62
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-21 62
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-21 62
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-21 62
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-21 62
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-21 62
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-21 62
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-21 62
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-21 62
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-21 62
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-21 62
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-21 62
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-21 62
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-21 62
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-21 62
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 4e-18 46
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-14 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0324 Protein 2e-26 63
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0323 Protein 5e-22 62
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0322 Protein 1e-25 60
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein NC_002695.1.913273.p Protein 8e-25 60
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0002 Protein 2e-24 60
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein NC_010410.6003348.p0 Protein 2e-24 60
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein CP001138.1.gene1489. Protein 3e-23 60
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0377 Protein 3e-22 59
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein CP004022.1.gene1549. Protein 3e-23 59
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0150 Protein 1e-24 58
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0140 Protein 3e-15 45
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein AE000516.2.gene3301. Protein 2e-12 45
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0249 Protein 2e-12 45
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0329 Protein 1e-15 45
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0139 Protein 5e-13 44
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0216 Protein 2e-07 41
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0477 Protein 5e-09 41
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein BAC0192 Protein 1e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein VFG1586 Protein 2e-18 46
emrE NP_902350.1 quaternary ammonium compound resistance protein / ethidium bromide resistant protein VFG1587 Protein 1e-14 44