Gene Information

Name : spaP (CV_2624)
Accession : NP_902294.1
Strain : Chromobacterium violaceum ATCC 12472
Genome accession: NC_005085
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein SpaP
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4790
EC number : -
Position : 2831526 - 2832188 bp
Length : 663 bp
Strand : -
Note : part of a type III secretory system probably involved in invasion into eukaryotic cells

DNA sequence :
ATGTCGAATGATATCTCGCTGATCGCGCTGCTGGCGTTTTCCACGCTGCTGCCTTTCCTGATCGCGTCCGGAACCTGTTT
CGTCAAGTTCTCCATCGTGTTCGTCATGGTGCGCAACGCGCTGGGTCTGCAGCAAGTGCCGTCCAACATGACGCTCAACG
GCATCGCGCTGATGCTGTCGATGTTCGTGATGCTGCCGGTTGCGCAGCAGGCCTACGGCTACTACCAGGAAGAGCGCGTC
AGCTTCACCAGCGTGGAGGCGGTCAACAACTTCGTCGAAAACGGGCTGGATGGTTACCGCGGCTATCTGCAGAAGTATTC
CGACCCTGAGCTGACCCGCTTCTTCGAGAAGGCGCAGAGCCAGCGCAGCGAGCGCGACGGCGGCGAGGCGGCGGCGCCGG
ACGACAAGCCGTCCATCTTCGCGCTGCTGCCGGCCTACGCCCTCAGCGAGATCAAGAGCGCCTTCAAGATCGGCTTCTAC
CTCTACCTGCCCTTCGTGGTGGTGGACCTGGTGATCTCCAGCGTGCTGCTGGCGCTGGGCATGATGATGATGAGTCCGGT
GACGATATCGGTGCCGATCAAGCTGGTGCTGTTCGTGGCGCTGGACGGCTGGACGCTGCTGTCCAAGGGGCTGGTGCTGC
AGTACCTGGATTTGGCGACGTAG

Protein sequence :
MSNDISLIALLAFSTLLPFLIASGTCFVKFSIVFVMVRNALGLQQVPSNMTLNGIALMLSMFVMLPVAQQAYGYYQEERV
SFTSVEAVNNFVENGLDGYRGYLQKYSDPELTRFFEKAQSQRSERDGGEAAAPDDKPSIFALLPAYALSEIKSAFKIGFY
LYLPFVVVDLVISSVLLALGMMMMSPVTISVPIKLVLFVALDGWTLLSKGLVLQYLDLAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 8e-72 76
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 8e-72 76
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 2e-71 75
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 2e-71 75
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 4e-67 73
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 2e-65 72
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 4e-67 69
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 3e-59 59
lscR AAO18040.1 LscR Virulence TTSS locus Protein 2e-37 47
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 4e-35 45
escR CAI43889.1 EscR protein Virulence LEE Protein 3e-35 45
escR AAK26700.1 EscR Virulence LEE Protein 3e-35 45
escR AAL57527.1 EscR Virulence LEE Protein 3e-35 45
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 4e-35 45
escR CAC81847.1 EscR protein Virulence LEE II Protein 3e-35 45
YPO0270 YP_002345352.1 type III secretion system protein Virulence Not named Protein 3e-33 44
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 3e-35 44
escR AAC38369.1 EscR Virulence LEE Protein 1e-34 44
escR AAC31528.1 L0049 Virulence LEE Protein 3e-35 44
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 3e-35 44
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 5e-35 44
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 5e-35 44
unnamed AAL06354.1 EscR Virulence LEE Protein 1e-32 42
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 4e-31 41
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG0551 Protein 3e-72 76
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG2455 Protein 1e-61 64
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG1773 Protein 3e-65 64
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG1012 Protein 1e-60 62
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG0394 Protein 6e-38 47
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG0188 Protein 8e-36 44
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG0715 Protein 7e-35 44
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG0827 Protein 2e-35 44
spaP NP_902294.1 surface presentation of antigens protein SpaP VFG0044 Protein 5e-30 42