Gene Information

Name : spaQ (CV_2623)
Accession : NP_902293.1
Strain : Chromobacterium violaceum ATCC 12472
Genome accession: NC_005085
Putative virulence/resistance : Virulence
Product : surface presentation of antigens secretory protein
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4794
EC number : -
Position : 2831168 - 2831428 bp
Length : 261 bp
Strand : -
Note : identified by sequence similarity; ORF located using Glimmer/GeneMark/Blastx/COG1987/TC:3.A.6.1.1

DNA sequence :
ATGAACGATCTGGTTTTCGCCGGCAACAAGGCGCTGTACCTGGTGCTGATGATGTCGGCCTGGCCCATCATCGTGGCCAC
CGTGATCGGCCTGCTGGTCGGTCTGTTCCAGACCGTGACCCAGCTGCAGGAACAGACGCTGCCTTTCGGCATCAAGCTGC
TGGGCGTCAGCGTGTGCCTGTTCCTGCTGTCCGGCTGGTACGGCGAGACCTTGCTCGCCTTCGGCCGCGAAGTGATGCGG
CTGGCGCTGGCCAAGGGATAG

Protein sequence :
MNDLVFAGNKALYLVLMMSAWPIIVATVIGLLVGLFQTVTQLQEQTLPFGIKLLGVSVCLFLLSGWYGETLLAFGREVMR
LALAKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 6e-30 84
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 6e-30 84
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 6e-30 84
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 6e-30 84
spaQ AAS66866.1 SpaQ Not tested SSR-2 Protein 9e-29 80
epaQ AAZ31292.1 EpaQ Virulence ETT2 Protein 7e-26 75
ECs3724 NP_311751.1 EpaQ Not tested LIM Protein 1e-25 74
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 4e-16 56
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 2e-11 47
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 1e-09 47
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 1e-09 47
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 1e-09 47
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 2e-09 45
lscS AAO18039.1 LscS Virulence TTSS locus Protein 4e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG0550 Protein 2e-30 84
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG1013 Protein 9e-23 71
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG2454 Protein 5e-17 60
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG1772 Protein 3e-20 54
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG0395 Protein 1e-10 47
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG0187 Protein 4e-04 46
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG0043 Protein 1e-07 43
spaQ NP_902293.1 surface presentation of antigens secretory protein VFG2132 Protein 1e-08 42