Gene Information

Name : phoB (PMM0705)
Accession : NP_892823.1
Strain : Prochlorococcus marinus CCMP1986
Genome accession: NC_005072
Putative virulence/resistance : Virulence
Product : two-component response regulator, phosphate
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 669400 - 670128 bp
Length : 729 bp
Strand : +
Note : -

DNA sequence :
ATGGCTGCTAAAGAACATAAAAGTTTGCAAGGATCAAAGATTCTTCTGATAGAAGATGATAAAAGTATTAGGCTTACTGT
TACTGAATCATTAATAAGTGAAGGTTTTGAAGTATCAAATTTTAAAGATGGGTCTAGTGCTTTAGATTTTATTTTGGGAG
AAGGAATAAAAGATTTTGATCTTATCCTTCTGGATTTAATGTTGCCAGGCTTAAATGGGTTAGAGTTATGCAGAAAAATA
AGAAATGAAGAATTATATACACCTATATTGATTTTGAGTGCAAAAGGAAATGAATCGGATAGGGTTCTTGGCTTAGAAGT
AGGAGCTGATGATTACCTAACAAAGCCATTTGGGATTAGTGAATTAATTGCTAGGTGCAGAGCCTTACTAAGAAGGTCTA
AAAGGGGTAAAGAAAAGAAACAAAAAATTGAAACGATAATCGAATATAAAAATATTAAGATGTTTACAGAAGAATGCAGA
GTAACAAATTTTAATCAAGAAATAATATTATCTCCAAAAGAATTCAAATTATTAGAATTATTTATCAAAAATCCTAAAAG
GGTATGGTCTAGGGATTTAATACTTGAAAAAATATGGGCTATAGATTTTATAGGAGATACAAAAACTGTGGATGTACATG
TTAGATGGCTTAGAGAAAAACTAGAAGAAAATCCCTCCGCGCCAAAAATTATAAAGACTGTTAGAGGTTTTGGATATAGG
TTCGGATGA

Protein sequence :
MAAKEHKSLQGSKILLIEDDKSIRLTVTESLISEGFEVSNFKDGSSALDFILGEGIKDFDLILLDLMLPGLNGLELCRKI
RNEELYTPILILSAKGNESDRVLGLEVGADDYLTKPFGISELIARCRALLRRSKRGKEKKQKIETIIEYKNIKMFTEECR
VTNFNQEIILSPKEFKLLELFIKNPKRVWSRDLILEKIWAIDFIGDTKTVDVHVRWLREKLEENPSAPKIIKTVRGFGYR
FG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-28 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB NP_892823.1 two-component response regulator, phosphate AE016830.1.gene1681. Protein 4e-34 43
phoB NP_892823.1 two-component response regulator, phosphate NC_002952.2859905.p0 Protein 2e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_012469.1.7686381. Protein 9e-34 42
phoB NP_892823.1 two-component response regulator, phosphate NC_013450.8614421.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_007793.3914279.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_007622.3794472.p0 Protein 2e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_002745.1124361.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_009782.5559369.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_002951.3237708.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_003923.1003749.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_002758.1121668.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_009641.5332272.p0 Protein 1e-31 42
phoB NP_892823.1 two-component response regulator, phosphate NC_002951.3238224.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_007793.3914065.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_002758.1121390.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_010079.5776364.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_002952.2859858.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_007622.3794948.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_003923.1003417.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate NC_013450.8614146.p0 Protein 2e-23 41
phoB NP_892823.1 two-component response regulator, phosphate HE999704.1.gene2815. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB NP_892823.1 two-component response regulator, phosphate VFG1563 Protein 3e-28 42
phoB NP_892823.1 two-component response regulator, phosphate VFG1702 Protein 5e-28 42