Gene Information

Name : S0523 (S0523)
Accession : NP_836230.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Unknown
Product : IS911 orfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 535386 - 535688 bp
Length : 303 bp
Strand : -
Note : residues 1 to 100 of 100 are 100.00 pct identical to residues 13 to 112 of 112 from GenPept : >gb|AAL72382.1| (AF386526) hypothetical protein [Shigella flexneri 2a]

DNA sequence :
ATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA
TGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGTGAGCTCAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQRIEME
NEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 7e-41 98
l7045 CAD33744.1 - Not tested PAI I 536 Protein 7e-41 98
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-34 95
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-39 94
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 77
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 77
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 77
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 77
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 77
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 77
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-31 77
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-31 77
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-29 72
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-24 62
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-24 62
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-23 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 9e-23 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 9e-23 60
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-23 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-22 58
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 6e-21 49
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-20 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S0523 NP_836230.1 IS911 orfA VFG1485 Protein 3e-41 98
S0523 NP_836230.1 IS911 orfA VFG1123 Protein 1e-31 77
S0523 NP_836230.1 IS911 orfA VFG1553 Protein 5e-30 72
S0523 NP_836230.1 IS911 orfA VFG0784 Protein 3e-23 60
S0523 NP_836230.1 IS911 orfA VFG1566 Protein 7e-13 42