Gene Information

Name : S4839 (S4839)
Accession : NP_839619.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Unknown
Product : P4-type integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 4386934 - 4388145 bp
Length : 1212 bp
Strand : -
Note : residues 1 to 403 of 403 are 91.58 pct identical to residues 1 to 404 of 431 from NRprotein_Feb03 : >ref|NP_668085.1| prophage P4 integrase [Yersinia pestis KIM] gb|AAM84336.1|AE013677_1 prophage P4 integrase [Yersinia pestis KIM]

DNA sequence :
ATGGCTCTGAGTGATGTGAAGGTTCGTTCGGCTAAGCCTGAAGCAAAAGCCTATAAGCTGACCGACGGTGAAGGCATGGT
TTTGCTGGTTCACCCTAACGGCTCCAAATACTGGCGGCTACGTTATCGCTTTGGCGGCAAAGAGAAGATGCTGGCATTGG
GGAAATACCCCGAAGTGTCGTTGGCGGATGCCAGGGCACGCCGGGATGAGGCTCGTAAGCTTTTAGCTAATGGTGTCGAT
CCCAGTGAAAACAAGAAAGCTGTTAAGGTAGAACAGGAACAAGAGGCGATAACGTTTGAAGTAGTCGCCAGAGACTGGCA
CGCCAGCAATCAGAAGTGGTCGGCATCGCATAGCGCTCGTGTTTTGAAAAGTCTGGAGGATAATCTCTTTACTGCTATCG
GTAAGCGGAACATTGCGGAACTGAAGACGCGGGATCTTCTTGTACCCATTAAAGCAGTCGAGTCATCCGGGCGGCTCGAA
GTTGCCGCCCGTTTACAGCAGCGTACTACCGCGATTATGCGCTTTGCCGTTCAGAGCGGCTTAATCGACTACAACCCCGC
GCAAGAGATTGCAGGTGCGGTTGCTACGGCGAAAAGACAGCACCGTGCAGCTCTTGAACTGAACCGTATACCTGAATTAC
TTCATCGCATAGATCACTATTCTGGCAGACCGTTAACTCGACTGGCGGTTGAACTCACTTTATTGGTTTTCATCCGTTCG
AGCGAGCTGCGTTTTGCCCGCTGGTCAGAAATAGATTTTGAAACGGCTATGTGGACAATCCCAGGTGAGCGTGAGCAACT
GGAAGGAGTCAAGCATTCTCAGCGTGGCTCGAAGATGCGGACACCACACCTTGTACCTTTGTCGCGGCAGGCCCTAAGTA
TTTTGGAAAAGATCAAAAGCATGAGCGGAAATCGAGAGCTGATTTTTGTGGGCGATCACGATCCACGTAAGCCGATGAGT
GAGAATACGGTGAACAAGGCTTTGCGCGTAATGGGGTATGACACGAAGGTCGAGGTTTGTGGGCATGGCTTCAGGACGAT
GGCTTGTAGTTCGTTGATTGAGTCGGGATTATGGTCGAGGGATGCGGTAGAGCGGCAGATGAGTCACCAGGAGCGTAGCT
CTGTGCGAGCAGCTTACATCCATAAGGCGGAACATCTTGGGGAGCGTAGGTTGATGTTTGAAGTGGTCAACAAAAACTGG
CCACCGAGTTAG

Protein sequence :
MALSDVKVRSAKPEAKAYKLTDGEGMVLLVHPNGSKYWRLRYRFGGKEKMLALGKYPEVSLADARARRDEARKLLANGVD
PSENKKAVKVEQEQEAITFEVVARDWHASNQKWSASHSARVLKSLEDNLFTAIGKRNIAELKTRDLLVPIKAVESSGRLE
VAARLQQRTTAIMRFAVQSGLIDYNPAQEIAGAVATAKRQHRAALELNRIPELLHRIDHYSGRPLTRLAVELTLLVFIRS
SELRFARWSEIDFETAMWTIPGEREQLEGVKHSQRGSKMRTPHLVPLSRQALSILEKIKSMSGNRELIFVGDHDPRKPMS
ENTVNKALRVMGYDTKVEVCGHGFRTMACSSLIESGLWSRDAVERQMSHQERSSVRAAYIHKAEHLGERRLMFEVVNKNW
PPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 5e-138 80
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 3e-134 70
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 3e-132 70
int AAK16198.1 Int Not tested PAI-I AL862 Protein 4e-134 70
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 4e-134 70
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 1e-133 70
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 2e-133 69
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 2e-134 69
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 2e-134 69
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 5e-134 69
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 7e-134 69
int-phe AAL60261.1 Int-phe Not tested LEE Protein 4e-134 69
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 3e-133 69
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 2e-133 69
int AAL51003.1 CP4-like integrase Not tested LEE Protein 1e-133 69
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 5e-134 69
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 5e-134 69
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 4e-134 69
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 5e-134 69
int AAL51028.1 CP4-like integrase Not tested LEE Protein 4e-134 69
int AAK00456.1 Int Not tested SHI-1 Protein 1e-124 69
int CAC81896.1 integrase Not tested LEE II Protein 3e-124 69
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 1e-119 63
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 1e-119 63
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 9e-109 58
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 6e-82 57
int YP_002346908.1 integrase Not tested HPI Protein 2e-100 56
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 2e-100 56
int2 NP_993013.1 integrase Not tested HPI Protein 2e-100 56
int CAA08754.1 integrase Not tested HPI Protein 6e-101 56
int CAA21384.1 - Not tested HPI Protein 2e-100 56
int CAB59974.1 integrase Not tested HPI Protein 1e-101 56
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 1e-86 56
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 2e-102 55
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 2e-102 55
unnamed AAD17660.1 unknown Not tested HPI Protein 2e-97 54
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 3e-97 54
aec33 AAW51716.1 Int Not tested AGI-3 Protein 1e-79 43
int AAD44730.1 Int Not tested SHI-2 Protein 7e-79 43
int CAC39282.1 integrase Not tested LPA Protein 2e-79 43
int AAC31482.1 CP4-like integrase Not tested LEE Protein 1e-77 42
int ACU09430.1 integrase Not tested LEE Protein 1e-77 42
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 2e-77 42
ECs4534 NP_312561.1 integrase Not tested LEE Protein 2e-77 42
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 1e-77 42
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 1e-77 42
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 1e-77 42
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 4e-68 41
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 3e-67 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S4839 NP_839619.1 P4-type integrase VFG1536 Protein 3e-138 80
S4839 NP_839619.1 P4-type integrase VFG1693 Protein 4e-134 70
S4839 NP_839619.1 P4-type integrase VFG0626 Protein 9e-135 69
S4839 NP_839619.1 P4-type integrase VFG0783 Protein 7e-78 42
S4839 NP_839619.1 P4-type integrase VFG0598 Protein 6e-78 42