Gene Information

Name : yeeW (S3205)
Accession : NP_838488.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3088315 - 3088803 bp
Length : 489 bp
Strand : +
Note : residues 5 to 52 of 162 are 79.16 pct identical to residues 2 to 49 of 64 from Escherichia coli K-12 : B2006

DNA sequence :
ATGAAACTGGCCCTGACGCTGGAAGCCGACAGCGTTAACGTGCAGGCACTGAACATGGGGCGCATTGTCGTTGACGTCGA
TGGTGTTAATCTCAGTGAACTGATTAACAAGGTCTCTGAAAACGGTTATTCACTCCGCGTGGTCGATAAATCCGACCAAC
ACGCAACCAGTACACCACCACCGTTAACAACCCTTACCTGCATACGTTGCAGCACCGCACATATCACGGAAACGGACAAC
GCCTGGCTGTACTCGCTGTCACACCAGACTAATGACGACGGCGAAACAGAATGGATTCATTTTACAGGCAGCGGCTATCT
GTTACGTACCGATGCATGGTCGTACCCGGTTCTGCGGCTTAAACGCCTGGGCCTGTCCAGAACGTTCCGTCGTCTGGTCG
TCACTCTCACCCGGCGTTATGGCGTCAGTCTCATTCATCTGGACGCCGGCGCAGAATGTCTGCCGGGGTTCCCCACTTTC
GACTGGTAA

Protein sequence :
MKLALTLEADSVNVQALNMGRIVVDVDGVNLSELINKVSENGYSLRVVDKSDQHATSTPPPLTTLTCIRCSTAHITETDN
AWLYSLSHQTNDDGETEWIHFTGSGYLLRTDAWSYPVLRLKRLGLSRTFRRLVVTLTRRYGVSLIHLDAGAECLPGFPTF
DW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 9e-58 100
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 9e-58 100
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 8e-51 100
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-55 96
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-55 96
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 3e-52 91
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 4e-52 89
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-51 88
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 2e-50 86
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 2e-50 86
unnamed AAL08479.1 unknown Not tested SRL Protein 2e-49 85
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 2e-49 84
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 2e-50 84
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 7e-51 84
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 1e-49 84
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 1e-49 84
unnamed AAC31487.1 L0008 Not tested LEE Protein 9e-50 84
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 9e-50 84
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 4e-50 83
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 6e-48 83
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 1e-48 83
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 5e-47 81
unnamed AAL57574.1 unknown Not tested LEE Protein 3e-41 80

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeW NP_838488.1 hypothetical protein VFG0664 Protein 3e-58 100
yeeW NP_838488.1 hypothetical protein VFG1070 Protein 8e-50 85
yeeW NP_838488.1 hypothetical protein VFG0787 Protein 4e-50 84
yeeW NP_838488.1 hypothetical protein VFG1621 Protein 2e-50 83
yeeW NP_838488.1 hypothetical protein VFG1683 Protein 4e-49 83
yeeW NP_838488.1 hypothetical protein VFG1531 Protein 2e-47 81