|
Name : S3190 (S3190) Accession : NP_838473.1 Strain : Shigella flexneri 2457T Genome accession: NC_004741 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3073538 - 3073744 bp Length : 207 bp Strand : + Note : residues 1 to 68 of 68 are 89.70 pct identical to residues 25 to 92 of 92 from GenPept : >gb|AAL08466.1| (AF326777) unknown [Shigella flexneri 2a] DNA sequence : ATGAATACCCCAGTTTCACTGATGGATGACCAGATGGTCGACATGTCGTTTATCACTCAGCTGACCGGCCTGACCGATAA GTGGTTTTATAAACTCATCAAGCATGGAGCCTTTCCGCCCCCCATCAAACTGGGCCGTAGCTCCCGCTGGCTGAAAAGCG AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA Protein sequence : MNTPVSLMDDQMVDMSFITQLTGLTDKWFYKLIKHGAFPPPIKLGRSSRWLKSEVEAWLQARIAQSRP |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-27 | 100 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-27 | 100 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-27 | 100 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 3e-26 | 95 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-25 | 92 |
| unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 2e-25 | 92 |
| unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 2e-25 | 92 |
| unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 1e-25 | 90 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-14 | 70 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-14 | 70 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-17 | 70 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 1e-17 | 70 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| S3190 | NP_838473.1 | hypothetical protein | VFG0651 | Protein | 7e-28 | 100 |
| S3190 | NP_838473.1 | hypothetical protein | VFG1057 | Protein | 6e-26 | 90 |
| S3190 | NP_838473.1 | hypothetical protein | VFG1480 | Protein | 5e-18 | 70 |
