Gene Information

Name : S3190 (S3190)
Accession : NP_838473.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3073538 - 3073744 bp
Length : 207 bp
Strand : +
Note : residues 1 to 68 of 68 are 89.70 pct identical to residues 25 to 92 of 92 from GenPept : >gb|AAL08466.1| (AF326777) unknown [Shigella flexneri 2a]

DNA sequence :
ATGAATACCCCAGTTTCACTGATGGATGACCAGATGGTCGACATGTCGTTTATCACTCAGCTGACCGGCCTGACCGATAA
GTGGTTTTATAAACTCATCAAGCATGGAGCCTTTCCGCCCCCCATCAAACTGGGCCGTAGCTCCCGCTGGCTGAAAAGCG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA

Protein sequence :
MNTPVSLMDDQMVDMSFITQLTGLTDKWFYKLIKHGAFPPPIKLGRSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-27 100
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-27 100
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-27 100
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-26 95
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-25 92
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 2e-25 92
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 2e-25 92
unnamed AAL08466.1 unknown Not tested SRL Protein 1e-25 90
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-14 70
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-14 70
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 1e-17 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-17 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S3190 NP_838473.1 hypothetical protein VFG0651 Protein 7e-28 100
S3190 NP_838473.1 hypothetical protein VFG1057 Protein 6e-26 90
S3190 NP_838473.1 hypothetical protein VFG1480 Protein 5e-18 70