|
Name : S2155 (S2155) Accession : NP_837606.1 Strain : Shigella flexneri 2457T Genome accession: NC_004741 Putative virulence/resistance : Unknown Product : IS911 orfA Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 2045315 - 2045545 bp Length : 231 bp Strand : - Note : residues 1 to 76 of 76 are 98.68 pct identical to residues 37 to 112 of 112 from GenPept : >gb|AAL72382.1| (AF386526) hypothetical protein [Shigella flexneri 2a]; partial DNA sequence : GTGGCAGATGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCA GGGCAAAACACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGTGAGCTCAGGAAAAAGCTACAACGCATTG AAATGGAGAATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA Protein sequence : MADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATALLMSDSLNSSR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 3e-29 | 98 |
| orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 3e-29 | 98 |
| insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 8e-28 | 94 |
| api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 4e-23 | 94 |
| unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 4e-22 | 75 |
| unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 2e-15 | 63 |
| RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 5e-14 | 56 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| S2155 | NP_837606.1 | IS911 orfA | VFG1485 | Protein | 1e-29 | 98 |
| S2155 | NP_837606.1 | IS911 orfA | VFG1553 | Protein | 2e-22 | 75 |
