Gene Information

Name : S2152 (S2152)
Accession : NP_837605.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Unknown
Product : integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 2043593 - 2044342 bp
Length : 750 bp
Strand : +
Note : residues 1 to 249 of 249 are 95.18 pct identical to residues 56 to 304 of 304 from GenPept : >emb|CAB59975.1| (AJ245585) integrase [Escherichia coli]

DNA sequence :
ATGCGCCATGCGGTCCATCAGGAGTTAATCGATACGAACCCTGCAGCAAACCTTGGCGGCGTGACCACACCTCCTGTCAG
ACGGCACTATCCTGCCCTGCCGCTGGAGCGGCTGCCTGAACTGCTTGAACGTATTGGGGCATATCATCAGGGCCGTGAAC
TGACCCGGCATGCCGTTCTGCTGATGCTGCATGTGTTCATTCGCTCCAGTGAACTGCGTTTCGCCCGCTGGTCAGAGATT
GATTTCACAAACCGAGTCTGGACGATACCCGCGACGCGAGAACCCATTATTGGCGTGCGTTATTCCGGCCGCGGGGCAAA
AATGCGAATGCCGCATATCGTCCCCCTCTCAGAACAGTCCATCGCCATTCTGAAACAGATTAAGGATATCACCGGTAATA
ATGAACTGATCTTCCCCGGCGACCATAACCCGTATAAGCCAATGTGTGAAAACACGGTCAATAAGGCACTGCGGGTGATG
GGTTACGACACGAAAAAGGATATCTGCGGTCACGGCTTCCGGGCAATGGCATGCAGTGCGCTGATGGAATCGGGTTTATG
GGCAAAGGACGCAGTAGAACGCCAGATGAGTCATCAGGAGCGCAATACCGTGCGCATGGCTTATATTCATAAGGCAGAGC
ACCTGGAAGCCCGCAAAGCGATGATGCAGTGGTGGTCGGATTATCTGGAAGCATGCCGAGAATCTTATGCACCGCCTTAT
ACAATTGGTAAAAATAAGTTTATCCCATAG

Protein sequence :
MRHAVHQELIDTNPAANLGGVTTPPVRRHYPALPLERLPELLERIGAYHQGRELTRHAVLLMLHVFIRSSELRFARWSEI
DFTNRVWTIPATREPIIGVRYSGRGAKMRMPHIVPLSEQSIAILKQIKDITGNNELIFPGDHNPYKPMCENTVNKALRVM
GYDTKKDICGHGFRAMACSALMESGLWAKDAVERQMSHQERNTVRMAYIHKAEHLEARKAMMQWWSDYLEACRESYAPPY
TIGKNKFIP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB ADN38949.1 P4-like integrase Not tested HPI Protein 7e-112 100
int ACR23154.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23138.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23124.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23155.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23143.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23129.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23156.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23144.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23130.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23157.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23146.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23131.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23161.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23147.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23132.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23164.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23148.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23134.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23165.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23149.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23135.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23122.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23167.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23153.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23137.1 P4-like integrase Not tested HPI Protein 8e-112 100
int ACR23123.1 P4-like integrase Not tested HPI Protein 8e-112 100
int CAB59975.1 integrase Not tested HPI Protein 4e-112 100
intB ADN38956.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23145.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23140.1 P4-like integrase Not tested HPI Protein 1e-111 99
int ACR23151.1 P4-like integrase Not tested HPI Protein 6e-111 99
intB ADN38964.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38957.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38947.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23150.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23152.1 P4-like integrase Not tested HPI Protein 6e-111 99
intB ADN38965.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38958.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38948.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23158.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23162.1 P4-like integrase Not tested HPI Protein 6e-111 99
intB ADN38966.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38959.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38951.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23159.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23163.1 P4-like integrase Not tested HPI Protein 6e-111 99
intB ADN38967.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38960.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38952.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23136.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23166.1 P4-like integrase Not tested HPI Protein 6e-111 99
int ACR23127.1 P4-like integrase Not tested HPI Protein 5e-110 99
intB ADN38968.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38961.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38953.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23139.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23125.1 P4-like integrase Not tested HPI Protein 4e-111 99
int ACR23160.1 P4-like integrase Not tested HPI Protein 5e-110 99
intB ADN38969.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38962.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB ADN38954.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23141.1 P4-like integrase Not tested HPI Protein 9e-112 99
intB ADN38950.1 P4-like integrase Not tested HPI Protein 2e-111 99
int ACR23126.1 P4-like integrase Not tested HPI Protein 4e-110 99
intB ADN38955.1 P4-like integrase Not tested HPI Protein 8e-112 99
int ACR23142.1 P4-like integrase Not tested HPI Protein 9e-112 99
int ACR23133.1 P4-like integrase Not tested HPI Protein 1e-111 99
int ACR23128.1 P4-like integrase Not tested HPI Protein 8e-111 99
intB ADN38963.1 P4-like integrase Not tested HPI Protein 8e-112 99
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 9e-113 99