Name : S2018 (S2018) Accession : NP_837501.1 Strain : Shigella flexneri 2457T Genome accession: NC_004741 Putative virulence/resistance : Unknown Product : IS911 orfA Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 1939126 - 1939428 bp Length : 303 bp Strand : - Note : residues 1 to 100 of 100 are 100.00 pct identical to residues 13 to 112 of 112 from GenPept : >gb|AAL72382.1| (AF386526) hypothetical protein [Shigella flexneri 2a] DNA sequence : ATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA TGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA CACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGTGAGCTCAGGAAAAAGCTACAACGCATTGAAATGGAG AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA Protein sequence : MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQRIEME NEILKKATALLMSDSLNSSR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 7e-41 | 98 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 7e-41 | 98 |
api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 1e-34 | 95 |
insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 3e-39 | 94 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-31 | 77 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 4e-31 | 77 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-31 | 77 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 4e-31 | 77 |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-31 | 77 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 3e-31 | 77 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-31 | 77 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-31 | 77 |
unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-29 | 72 |
ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 3e-24 | 62 |
aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 2e-24 | 62 |
unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 8e-23 | 60 |
unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 6e-23 | 60 |
Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 9e-23 | 60 |
ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 9e-23 | 60 |
RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 2e-22 | 58 |
trp1329A | CAB46577.1 | IS1329 transposase A | Not tested | HPI | Protein | 6e-21 | 49 |
tnpA | CAB61575.1 | transposase A | Not tested | HPI | Protein | 2e-20 | 48 |
unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-12 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
S2018 | NP_837501.1 | IS911 orfA | VFG1485 | Protein | 3e-41 | 98 |
S2018 | NP_837501.1 | IS911 orfA | VFG1123 | Protein | 1e-31 | 77 |
S2018 | NP_837501.1 | IS911 orfA | VFG1553 | Protein | 5e-30 | 72 |
S2018 | NP_837501.1 | IS911 orfA | VFG0784 | Protein | 3e-23 | 60 |
S2018 | NP_837501.1 | IS911 orfA | VFG1566 | Protein | 7e-13 | 42 |