Gene Information

Name : BC4539 (BC4539)
Accession : NP_834246.1
Strain : Bacillus cereus ATCC 14579
Genome accession: NC_004722
Putative virulence/resistance : Resistance
Product : two-component response regulator ycbL
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4483120 - 4483812 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGTCACATCATATTTTATTAGTTGAAGATGATATCTCAATTCAAGAGATGGTGGAAAAGTATTTAATAAAAGAGGGTTT
TCAAGTAACAATTGCGTCTGATGGAGAGGAAGGCGTGAACACATATTTAAAAGGTTCATTTGATTTGATTATCCTTGACA
TTATGATGCCAAAGCTAGATGGCTTAGAAGTTGTACGAATCATTCGAGAAAAAAGTGCTGTTCCGATTTTAATGATGTCG
GCAAAAGATACAGATGTTGATAAAGCTGTTGGATTAGGACTTGGAGCAGATGATTACATTTGTAAGCCGTTTTCTATGAT
TGAATTAGCTGCACGTGTAAAAGCGGGTATTCGGAGGTCTACGAAATATTCGGCTACAGAAACAACAGAAAAGATGATTC
AAATTGGTGATTTAACAATTGATCCAATTAATTTTACAGTTGAAAAAAACGGGAAGTCTCTCAAACTTACTTTAAAAGAA
TTTGAGATTTTAAAGCTATTCGTAAAGAACCAAAATCGTGTATTTACGAAAGCGCAAATATATACATTAGTTTGGAATGA
AGAGTATTACGGTGACGATAACGTTATTAATGTTCATATGAGAAGATTGCGTGAGAAAATCGAAAGTGATCCATCTAATC
CAGAATATATTAAAACGTTATGGGGCATCGGCTATAAGTTGGAAGTGATGTAA

Protein sequence :
MSHHILLVEDDISIQEMVEKYLIKEGFQVTIASDGEEGVNTYLKGSFDLIILDIMMPKLDGLEVVRIIREKSAVPILMMS
AKDTDVDKAVGLGLGADDYICKPFSMIELAARVKAGIRRSTKYSATETTEKMIQIGDLTIDPINFTVEKNGKSLKLTLKE
FEILKLFVKNQNRVFTKAQIYTLVWNEEYYGDDNVINVHMRRLREKIESDPSNPEYIKTLWGIGYKLEVM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC4539 NP_834246.1 two-component response regulator ycbL AF155139.2.orf0.gene Protein 4e-46 47
BC4539 NP_834246.1 two-component response regulator ycbL NC_012469.1.7685629. Protein 2e-45 46
BC4539 NP_834246.1 two-component response regulator ycbL NC_002952.2859905.p0 Protein 5e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_007622.3794472.p0 Protein 5e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_002745.1124361.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_009782.5559369.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_002951.3237708.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_003923.1003749.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_002758.1121668.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_009641.5332272.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_013450.8614421.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_007793.3914279.p0 Protein 7e-43 45
BC4539 NP_834246.1 two-component response regulator ycbL HE999704.1.gene2815. Protein 2e-42 45
BC4539 NP_834246.1 two-component response regulator ycbL NC_005054.2598277.p0 Protein 4e-43 44
BC4539 NP_834246.1 two-component response regulator ycbL NC_014475.1.orf0.gen Protein 4e-43 44
BC4539 NP_834246.1 two-component response regulator ycbL FJ349556.1.orf0.gene Protein 6e-44 43
BC4539 NP_834246.1 two-component response regulator ycbL BAC0308 Protein 5e-36 42
BC4539 NP_834246.1 two-component response regulator ycbL AF310956.2.orf0.gene Protein 3e-36 41
BC4539 NP_834246.1 two-component response regulator ycbL AE016830.1.gene1681. Protein 3e-40 41