Gene Information

Name : EFA0016 (EFA0016)
Accession : NP_816945.1
Strain :
Genome accession: NC_004669
Putative virulence/resistance : Unknown
Product : IS6 family transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3316
EC number : -
Position : 12615 - 13304 bp
Length : 690 bp
Strand : -
Note : Related to but different from IS1216.; similar to GP:1019106, and GP:2467239; identified by sequence similarity; putative

DNA sequence :
ATGAAAAATCAGTTTAAAGGAAAACAGTATGACTATCGAATTATTATAGAAGCCATCGGGTTATACTATCACTTTTCTTT
GAGCTATCGTGATTGTGCCAAAATCATGCGTAAATTTAGTGTTGGCGTGGATCATACCACAATTTACCGCTGGAACAAAG
AGTATGGAAAAATCCTTTATCATCTATGGAATAAACGTAGATCCTTATCAAAATCCTGGCGGATTGATGAGACCTATGTC
AAAGTGAAAGGTCAAGATCGGTATCTTTATCGAGCCATTGATTCGAAGGGCAATACGTTAGATATGTGGCTACGAAACCA
TCGTGATACTGTCTCTACTAAAGCCTTTTTCAAGCGTCTAATCAGAGTCTACGGTCAACCACGTTCCATTGTAACAGATA
AATATGCTCCTTCATTAAAAGCGATCAAAGAGCTGAAAGAAGAAGGAATTCTATACCAAAAAGTGAAGCATTGGAAGTCG
AAATACCTCAATAATATTCTTGAACAGGATCACCGACAGTTGAAGGGGAAGCTTCCTTATGGCAACAACTTTCAGTCCAC
CTATACAGCTGCAGTAACGATTAAAGGAATCGAAGTTGTTTCTGCTTTATACAAAGAAAGTCGAAGAGAAATTGGTCTCT
TCGACTTTTCCCCGTGGGAAGAAATTGATACTCTATTCAAATCAGCTTAA

Protein sequence :
MKNQFKGKQYDYRIIIEAIGLYYHFSLSYRDCAKIMRKFSVGVDHTTIYRWNKEYGKILYHLWNKRRSLSKSWRIDETYV
KVKGQDRYLYRAIDSKGNTLDMWLRNHRDTVSTKAFFKRLIRVYGQPRSIVTDKYAPSLKAIKELKEEGILYQKVKHWKS
KYLNNILEQDHRQLKGKLPYGNNFQSTYTAAVTIKGIEVVSALYKESRREIGLFDFSPWEEIDTLFKSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 3e-42 49
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 2e-40 47
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 8e-41 47
ef0039 AAM75245.1 EF0039 Not tested Not named Protein 2e-36 47
SE0071 NP_763626.1 transposase for IS-like element Not tested SCCpbp4 Protein 1e-39 46
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 2e-40 46
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 8e-40 46
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 2e-40 46
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 2e-40 46
SERP1579 YP_189144.1 IS431mec-like transposase Not tested ¥ÕSP¥â Protein 6e-40 46
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 2e-40 46
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 2e-40 46
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 2e-40 46
SE0079 NP_763634.1 transposase for IS-like element Not tested SCCpbp4 Protein 6e-40 46
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 2e-40 46
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 5e-40 46
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 2e-40 46
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 4e-40 46
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 2e-40 46
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-40 46
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 2e-40 46
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 4e-40 46
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 1e-40 46
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-40 46
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 2e-40 46
tnp YP_251940.1 transposase for IS431mec Not tested SCCmec Protein 4e-40 46
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 2e-40 46
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 2e-40 46
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 2e-40 46
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 2e-40 46
unnamed BAD24828.1 transposase for IS431 Not tested Type-V SCCmec Protein 2e-39 46
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 2e-40 46
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 2e-40 46
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 1e-39 46
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 2e-40 46
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 8e-40 46
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 2e-40 46
unnamed AAP55235.1 transposase Not tested SaPIbov2 Protein 5e-40 46
tnp YP_254240.1 transposase for IS431mec Not tested ¥ðSh1 Protein 5e-39 45
IS26 CAJ77080.1 Insertion sequence Not tested AbaR1 Protein 9e-17 42