Gene Information

Name : BT_0682 (BT_0682)
Accession : NP_809595.1
Strain : Bacteroides thetaiotaomicron VPI-5482
Genome accession: NC_004663
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 846392 - 847129 bp
Length : 738 bp
Strand : -
Note : -

DNA sequence :
ATGCCGTTTTTCTTTCTTCGGATGCAAAGAAAAAGTATCTTTGCATCTAAACAATGTAGATTTATGGCAAAGATACTATT
AGCAGAAGATGAAGTCAATATCGCCTCCTTTATCGAACGGGGACTGAAAGAGTTCGGACATTCGGTAACAGTCTGTCATG
ACGGAAATACGGGTTGGAGAATCCTTCAGGAAGAACCTTTCGACCTTGTAATCCTGGATATTATCATGCCGAAAATAAAC
GGGCTCGAACTTTGCCATCTCTATCGGCAGATGTTCGGTTACCAGGCACCGGTCATTATGCTGACGGCTTTAGGCACTAC
GGAAGACATTGTAAAAGGACTGGATGCAGGAGCAGACGATTATCTTGTCAAGCCTTTCAGTTTTCAGGAACTGGAAGCAC
GTATCAAGGCGCTGCTGCGACGAAACAAGGAGACTGTAACCAATCAACTGACTTGCGACAATCTGGTATTGGACTGTAAC
ACCAGACGGGCGAAAAGAGGTGATGCGGATATCGATCTCACCGTAAAAGAATACCGTCTGCTCGAATATTTCATGACTCA
CCAAGGGGTAGCCTTATCGCGCATTACGCTGCTCAAAGACGTATGGGACAAGAACTTTGATACGAATACCAACATCGTAG
ACGTATACGTCAATTATCTGCGGGTAAAGATAGACCGTGACTTCGACAAGAAACTGATTCATACAGTAGTAGGATTAGGA
TATATCATGAATGCCTGA

Protein sequence :
MPFFFLRMQRKSIFASKQCRFMAKILLAEDEVNIASFIERGLKEFGHSVTVCHDGNTGWRILQEEPFDLVILDIIMPKIN
GLELCHLYRQMFGYQAPVIMLTALGTTEDIVKGLDAGADDYLVKPFSFQELEARIKALLRRNKETVTNQLTCDNLVLDCN
TRRAKRGDADIDLTVKEYRLLEYFMTHQGVALSRITLLKDVWDKNFDTNTNIVDVYVNYLRVKIDRDFDKKLIHTVVGLG
YIMNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-34 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BT_0682 NP_809595.1 two-component system response regulator BAC0347 Protein 3e-41 45
BT_0682 NP_809595.1 two-component system response regulator BAC0111 Protein 1e-44 45
BT_0682 NP_809595.1 two-component system response regulator BAC0083 Protein 9e-39 44
BT_0682 NP_809595.1 two-component system response regulator BAC0638 Protein 4e-33 43
BT_0682 NP_809595.1 two-component system response regulator BAC0125 Protein 4e-40 42
BT_0682 NP_809595.1 two-component system response regulator BAC0197 Protein 1e-36 42
BT_0682 NP_809595.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-31 41
BT_0682 NP_809595.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-29 41
BT_0682 NP_809595.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-32 41
BT_0682 NP_809595.1 two-component system response regulator BAC0308 Protein 6e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BT_0682 NP_809595.1 two-component system response regulator VFG0596 Protein 3e-34 44
BT_0682 NP_809595.1 two-component system response regulator VFG1389 Protein 2e-35 42