
| Name : rpmE2 (BT_1692) Accession : NP_810605.1 Strain : Bacteroides thetaiotaomicron VPI-5482 Genome accession: NC_004663 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 2088036 - 2088290 bp Length : 255 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAAAAAGGCCTTCATCCAGAATCATACCGTCCGGTAGTATTCAAAGATATGTCAAATGGTGATATGTTTTTGTCTAA ATCAACTGTAGCAACTAAAGAAACCATCGAATTCGAAGGTGAAACTTATCCGTTGCTGAAGATTGAAATCTCTAACACTT CTCACCCGTTCTATACAGGTAAATCTACATTGGTAGATACTGCAGGTCGCGTTGATAAGTTCATGAGCCGTTACGGTGAC CGTAAGAAGAAATAA Protein sequence : MKKGLHPESYRPVVFKDMSNGDMFLSKSTVATKETIEFEGETYPLLKIEISNTSHPFYTGKSTLVDTAGRVDKFMSRYGD RKKK | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 6e-13 | 49 | 
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 6e-13 | 49 | 
 
 
  