Gene Information

Name : t3445 (t3445)
Accession : NP_807107.1
Strain : Salmonella enterica Ty2
Genome accession: NC_004631
Putative virulence/resistance : Unknown
Product : positive regulator of late gene transcription
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3534417 - 3534635 bp
Length : 219 bp
Strand : +
Note : corresponds to STY3703 from Accession AL513382: Salmonella typhi CT18

DNA sequence :
ATGATGATTTGCCCACTGTGTGGAAGTGCCGCCCATACTCGCAGCAGTTTTCAGGTATCTTCATTGACCAAAGAGCGTTA
CAACCAGTGCCAGAACATTAACTGCAGCCATACTTTTGTTACCCATGAAACTTTTGTTCGTTCGATTGCAACGCCAAAAG
AGTCAAATCCGGTTCAGCCGCATCCAATGAAATCAGGACAGGTGGCGCTCTCTCTTTGA

Protein sequence :
MMICPLCGSAAHTRSSFQVSSLTKERYNQCQNINCSHTFVTHETFVRSIATPKESNPVQPHPMKSGQVALSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
STY4600 NP_458683.1 putative positive regulator of late gene transcription Not tested SPI-7 Protein 5e-15 64
t4294 NP_807891.1 positive regulator of late gene transcription Not tested SPI-7 Protein 5e-15 64