Name : t3445 (t3445) Accession : NP_807107.1 Strain : Salmonella enterica Ty2 Genome accession: NC_004631 Putative virulence/resistance : Unknown Product : positive regulator of late gene transcription Function : - COG functional category : - COG ID : - EC number : - Position : 3534417 - 3534635 bp Length : 219 bp Strand : + Note : corresponds to STY3703 from Accession AL513382: Salmonella typhi CT18 DNA sequence : ATGATGATTTGCCCACTGTGTGGAAGTGCCGCCCATACTCGCAGCAGTTTTCAGGTATCTTCATTGACCAAAGAGCGTTA CAACCAGTGCCAGAACATTAACTGCAGCCATACTTTTGTTACCCATGAAACTTTTGTTCGTTCGATTGCAACGCCAAAAG AGTCAAATCCGGTTCAGCCGCATCCAATGAAATCAGGACAGGTGGCGCTCTCTCTTTGA Protein sequence : MMICPLCGSAAHTRSSFQVSSLTKERYNQCQNINCSHTFVTHETFVRSIATPKESNPVQPHPMKSGQVALSL |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
STY4600 | NP_458683.1 | putative positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 5e-15 | 64 |
t4294 | NP_807891.1 | positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 5e-15 | 64 |