Name : prgI (t2775) Accession : NP_806476.1 Strain : Salmonella enterica Ty2 Genome accession: NC_004631 Putative virulence/resistance : Virulence Product : pathogenicity island 1 effector protein Function : - COG functional category : - COG ID : - EC number : - Position : 2853946 - 2854188 bp Length : 243 bp Strand : - Note : corresponds to STY2994 from Accession AL513382: Salmonella typhi CT18 DNA sequence : ATGCCAACATCTTGGTCAGGCTATCTGGATGAAGTTTCAGCAAAATTTGATAAGGGCGTTGATAATCTACAAACGCAGGT AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT TAA Protein sequence : MPTSWSGYLDEVSAKFDKGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
prgI | NP_806476.1 | pathogenicity island 1 effector protein | Virulence | SPI-1 | Protein | 1e-30 | 100 |
prgI | NP_457267.1 | pathogenicity 1 island effector protein | Virulence | SPI-1 | Protein | 1e-30 | 100 |
prgI | AAX49613.1 | PrgI | Virulence | SPI-1 | Protein | 1e-29 | 95 |
prgI | YP_217792.1 | cell invasion protein | Virulence | SPI-1 | Protein | 1e-29 | 95 |
prgI | NP_461794.1 | needle complex major subunit | Virulence | SPI-1 | Protein | 1e-29 | 95 |
ECs3718 | NP_311745.1 | EprI | Not tested | LIM | Protein | 3e-20 | 62 |
ysaG | AAS66835.1 | YsaG | Not tested | SSR-1 | Protein | 2e-16 | 50 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
prgI | NP_806476.1 | pathogenicity island 1 effector protein | VFG0535 | Protein | 4e-30 | 95 |
prgI | NP_806476.1 | pathogenicity island 1 effector protein | VFG0996 | Protein | 2e-19 | 69 |
prgI | NP_806476.1 | pathogenicity island 1 effector protein | VFG2466 | Protein | 1e-17 | 56 |