Gene Information

Name : prgI (t2775)
Accession : NP_806476.1
Strain : Salmonella enterica Ty2
Genome accession: NC_004631
Putative virulence/resistance : Virulence
Product : pathogenicity island 1 effector protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2853946 - 2854188 bp
Length : 243 bp
Strand : -
Note : corresponds to STY2994 from Accession AL513382: Salmonella typhi CT18

DNA sequence :
ATGCCAACATCTTGGTCAGGCTATCTGGATGAAGTTTCAGCAAAATTTGATAAGGGCGTTGATAATCTACAAACGCAGGT
AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT
ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT
TAA

Protein sequence :
MPTSWSGYLDEVSAKFDKGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
prgI NP_806476.1 pathogenicity island 1 effector protein Virulence SPI-1 Protein 1e-30 100
prgI NP_457267.1 pathogenicity 1 island effector protein Virulence SPI-1 Protein 1e-30 100
prgI AAX49613.1 PrgI Virulence SPI-1 Protein 1e-29 95
prgI YP_217792.1 cell invasion protein Virulence SPI-1 Protein 1e-29 95
prgI NP_461794.1 needle complex major subunit Virulence SPI-1 Protein 1e-29 95
ECs3718 NP_311745.1 EprI Not tested LIM Protein 3e-20 62
ysaG AAS66835.1 YsaG Not tested SSR-1 Protein 2e-16 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prgI NP_806476.1 pathogenicity island 1 effector protein VFG0535 Protein 4e-30 95
prgI NP_806476.1 pathogenicity island 1 effector protein VFG0996 Protein 2e-19 69
prgI NP_806476.1 pathogenicity island 1 effector protein VFG2466 Protein 1e-17 56