Gene Information

Name : t2651 (t2651)
Accession : NP_806362.1
Strain : Salmonella enterica Ty2
Genome accession: NC_004631
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2740629 - 2740847 bp
Length : 219 bp
Strand : +
Note : similar to Bacteriophage P4 DNA-binding protein (CAA35903)

DNA sequence :
ATGCCGCTGCCGGACATCACGCAGGAGCGTTTTTTACGTCTGCCGGAAGTGATGCACCTGTGCGGCCTGTCACGCTCGAC
CATCTACGAACTCATCCGTAAGGGGGAATTTCCGCCGCAGGTGAGTCTTGGCGGTAAAAATGTGGCCTGGCTGCACTCTG
AAATCACCGCATGGATGGCCGGACGCATTGCCGGACGCAAACGGGGGTACGACGCATGA

Protein sequence :
MPLPDITQERFLRLPEVMHLCGLSRSTIYELIRKGEFPPQVSLGGKNVAWLHSEITAWMAGRIAGRKRGYDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-11 53
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 4e-10 49
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 6e-10 49
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 6e-10 49
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 6e-12 49
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 4e-12 49
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 6e-12 49
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 2e-06 41
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 3e-08 41
unnamed CAA21398.1 - Not tested HPI Protein 4e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
t2651 NP_806362.1 hypothetical protein VFG1118 Protein 2e-10 49
t2651 NP_806362.1 hypothetical protein VFG1141 Protein 2e-12 49