Gene Information

Name : SPs1615 (SPs1615)
Accession : NP_802877.1
Strain : Streptococcus pyogenes SSI-1
Genome accession: NC_004606
Putative virulence/resistance : Virulence
Product : two-component response regulator CsrR/CovR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1612428 - 1613114 bp
Length : 687 bp
Strand : -
Note : similar to GB:AAC64935.1 (AF082668) percent identity 99 in 228 aa

DNA sequence :
ATGACAAAGAAAATTTTAATTATTGAAGATGAAAAGAATCTGGCTAGATTCGTTTCTCTTGAGCTGCAACATGAGGGGTA
TGAAGTCATTGTTGAGGTCAATGGTCGTGAAGGGTTAGAAACTGCTTTGGAAAAAGAGTTTGATTTAATCCTGCTTGACT
TAATGTTACCAGAGATGGATGGTTTTGAAGTGACCCGTCGTTTGCAAACCGAAAAAACAACGTATATCATGATGATGACT
GCGCGTGATTCTATTATGGATGTGGTTGCAGGTTTAGACCGCGGTGCAGACGACTATATTGTTAAACCGTTTGCCATTGA
AGAACTACTTGCCCGTATTCGTGCTATTTTCTGCCGTCAAGATATTGAATCTGAGAAGAAAGTGCCTAGTCAAGGCATTT
ATCGAGATCTAGTTTTAAATCCACAAAACCGTTCAGTTAATCGTGGCGACGATGAGATTTCTCTCACTAAACGTGAATAT
GATTTGCTTAATATTTTGATGACTAATATGAATCGTGTCATGACACGTGAAGAATTATTGTCAAATGTTTGGAAATATGA
TGAAGCCGTTGAGACTAATGTTGTAGATGTCTATATTCGTTATCTCCGCGGCAAAATTGACATTCCAGGCAAGGAATCTT
ATATCCAAACAGTGCGTGGCATGGGATACGTTATTCGTGAGAAATAA

Protein sequence :
MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEKEFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMT
ARDSIMDVVAGLDRGADDYIVKPFAIEELLARIRAIFCRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREY
DLLNILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIREK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-36 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR HE999704.1.gene1528. Protein 2e-58 61
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_003923.1003417.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_013450.8614146.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_002951.3238224.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_007793.3914065.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_002758.1121390.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_010079.5776364.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_002952.2859858.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_007622.3794948.p0 Protein 7e-50 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR AE015929.1.gene1106. Protein 6e-48 53
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR NC_012469.1.7685629. Protein 1e-37 42
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR BAC0125 Protein 4e-35 42
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR HE999704.1.gene2815. Protein 2e-38 42
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR AE016830.1.gene1681. Protein 2e-38 41
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR BAC0197 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR VFG1390 Protein 3e-40 43
SPs1615 NP_802877.1 two-component response regulator CsrR/CovR VFG0596 Protein 6e-37 43