Gene Information

Name : terD (PSPTO_0944)
Accession : NP_790783.1
Strain : Pseudomonas syringae DC3000
Genome accession: NC_004578
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1021393 - 1021968 bp
Length : 576 bp
Strand : +
Note : similar to SP:P18781; identified by sequence similarity; putative; see PMID:20190049 for expression data; similar to SP:P18781, identified by sequence similarity, putative

DNA sequence :
ATGGCTTTGACTCTGCAAAAAGGTGGCAACCTTTCGCTGTCGAAAACCGACCCGACCCTCACCAGCGTATTGATTGGTCT
GGGCTGGGATCCGCGTGCCACTGACGGCCAGGAGTTTGACCTGGACGCCAGCGCATTCCTGCTGAGCGCCAATGGCAAGG
TCCGCAGTGAAGCTGACTTCATTTTCTACAACCAGCTAAAAAGTGCTGATGGCTCCGTCGAGCATACCGGCGACAACCGT
ACCGGTGCTGGCGATGGCGACGACGAAGTGCTCAAGGTCGATCTGACCCGCGTACCTGCCGATGTCGACAAGGTCGTTTT
TGTCGTGACCATTCACGATGCCGACAGCCGCAAGCAGAATTTCGGTCAGGTGGGTGGCTCGTTCATCCGCGTCCTGAATG
AAAAGTCCGGCTCTGAAGTTGTTCGTTATGACCTGGCAGAAGACGCTTCGACCGAAACTGCAATGGTGTTTGCCGAGCTG
TATCGCAACGCTGGCGAGTGGAAGTTTCGTGCGGTTGGCCAAGGTTATGCCGGTGGCCTGAAAGCGGTTGCCAACTCTTT
CGGCATGAATTTCTAA

Protein sequence :
MALTLQKGGNLSLSKTDPTLTSVLIGLGWDPRATDGQEFDLDASAFLLSANGKVRSEADFIFYNQLKSADGSVEHTGDNR
TGAGDGDDEVLKVDLTRVPADVDKVVFVVTIHDADSRKQNFGQVGGSFIRVLNEKSGSEVVRYDLAEDASTETAMVFAEL
YRNAGEWKFRAVGQGYAGGLKAVANSFGMNF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-64 79
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-58 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-50 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-51 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD NP_790783.1 tellurium resistance protein TerD BAC0389 Protein 4e-58 71
terD NP_790783.1 tellurium resistance protein TerD BAC0390 Protein 3e-53 65