Gene Information

Name : PSPTO_5344 (PSPTO_5344)
Accession : NP_795075.1
Strain : Pseudomonas syringae DC3000
Genome accession: NC_004578
Putative virulence/resistance : Unknown
Product : site-specific recombinase, phage integrase family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 6074827 - 6076035 bp
Length : 1209 bp
Strand : +
Note : similar to GP:14252927; identified by sequence similarity; putative

DNA sequence :
TTGCCGTTGTCAGATACCACCATCCGTACCGCAAAGCCCAAGGACAAGCTTTATCGCCTGACCGATGCCAACGGCCTTTG
CCTTGAAATCGCTCCATCGGGATCGAAGCTCTGGCGATATCGATATCGCTTTAACGGCAAAGCAAAGATGCTGGCGCTTG
GTGCCTACCCAGCTGTCACTCTTCTGAAAGCTCGCCAGCTCCGCGATAGTGCACGTCAGTTGCTGGTTGAGGGCAATGAT
CCCGGCGAGCACAAAAAAACCGCTCAGCAAGCACAGAAGGTTGAAGGGCTGACTTTTGAAACACTTGCCCGTGAGTGGTT
CGCGTACAACTCCCCCCGCTGGGCAGAGAGCACCACCTATAAGGCCAAGCTTTATATGGAGAACGACCTTATTCCCGGTA
TCGGTGCCCGTCCGGTGAAAGCGCTCACCCGGCCCGATCTGGTTGATCTGGTGCGCAAGGTGGAGGCCCGCGGCACATTG
AATGCGGCTGGCAAGATCCGTCAGTGGCTGCACCAGATATTCCGTTACGGCCTGGCAAAGGGAGTTGTCGAGAGCAACCC
GGCCACCGACCTGGACGTTGTAGCCGCGCCGCAGAAAGCGCCCCGTCATCATCCACATGTGCCGTTCTCAGAATTACCCG
AGCTTCTTGAGATATGCGACGGGTCTAAGATCAACACATTGACCCGATGCGCCATTCACTTACTGGTGCTGACCGCCGTT
CGACCAGGCGAGCTGCGAAATGCCCCTTGGTCAGAGTTCGATCTGGATGCTGCTACTTGGGCTATCCCAAAGGAGCGAAT
GAAAGCTCGCAGACCTCATGTCGTCCCCCTACCCACTCAAGCGGTCGACATCCTGCGCCAGCTCCAGCCAATCACAGGTC
GATACCCGTTGGTATTCGCTGGCCAGCACAACCCCAGCCGACCAATGAGCGAGAACACGATCAATAAAGCACTGCGCTTG
TTGGGCTACGAGAATCGTCAAACCGGCCACGGCTTCCGCCATTTGCTTTCCACCGAGCTCAATGGGCGCGGGTATAACAA
AGACTGGATAGAGCGCCAGCTTGCGCACGGTGACGCTGACGGCATCCGCGACACCTACAACCATGCCAGCTATCTGGAGC
AGCGCCGGGGAATGATGCAGGCCTGGGCCGACTCAATCGACGCGCTAAGTGCTGGCTCCAACGTGGTGAGCATCAAGCGC
CAGGCTTAA

Protein sequence :
MPLSDTTIRTAKPKDKLYRLTDANGLCLEIAPSGSKLWRYRYRFNGKAKMLALGAYPAVTLLKARQLRDSARQLLVEGND
PGEHKKTAQQAQKVEGLTFETLAREWFAYNSPRWAESTTYKAKLYMENDLIPGIGARPVKALTRPDLVDLVRKVEARGTL
NAAGKIRQWLHQIFRYGLAKGVVESNPATDLDVVAAPQKAPRHHPHVPFSELPELLEICDGSKINTLTRCAIHLLVLTAV
RPGELRNAPWSEFDLDAATWAIPKERMKARRPHVVPLPTQAVDILRQLQPITGRYPLVFAGQHNPSRPMSENTINKALRL
LGYENRQTGHGFRHLLSTELNGRGYNKDWIERQLAHGDADGIRDTYNHASYLEQRRGMMQAWADSIDALSAGSNVVSIKR
QA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
int CAC39282.1 integrase Not tested LPA Protein 6e-86 47
aec33 AAW51716.1 Int Not tested AGI-3 Protein 5e-86 47
int AAD44730.1 Int Not tested SHI-2 Protein 2e-86 47
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 1e-83 47
int AAC31482.1 CP4-like integrase Not tested LEE Protein 3e-84 46
int ACU09430.1 integrase Not tested LEE Protein 3e-84 46
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 5e-84 46
ECs4534 NP_312561.1 integrase Not tested LEE Protein 5e-84 46
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 3e-84 46
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 3e-84 46
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 2e-84 46
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 1e-74 46
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 1e-74 46
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 7e-82 44
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 3e-68 44
int AAK16198.1 Int Not tested PAI-I AL862 Protein 7e-70 44
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 7e-70 44
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 5e-70 44
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 6e-69 43
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 5e-69 43
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 5e-69 43
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 8e-70 43
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 8e-70 43
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 6e-69 43
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 5e-68 43
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 5e-69 43
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 8e-69 43
int AAL51028.1 CP4-like integrase Not tested LEE Protein 8e-69 43
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 2e-68 43
int-phe AAL60261.1 Int-phe Not tested LEE Protein 8e-69 43
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 1e-68 43
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 1e-68 43
int AAL51003.1 CP4-like integrase Not tested LEE Protein 8e-69 43
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 2e-68 43
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 2e-68 43
int AAK00456.1 Int Not tested SHI-1 Protein 2e-61 42
int CAC81896.1 integrase Not tested LEE II Protein 2e-60 42
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 5e-65 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPTO_5344 NP_795075.1 site-specific recombinase, phage integrase family VFG0783 Protein 2e-84 46
PSPTO_5344 NP_795075.1 site-specific recombinase, phage integrase family VFG0598 Protein 1e-84 46
PSPTO_5344 NP_795075.1 site-specific recombinase, phage integrase family VFG0626 Protein 4e-70 43
PSPTO_5344 NP_795075.1 site-specific recombinase, phage integrase family VFG1693 Protein 2e-69 43