Gene Information

Name : CTC00805 (CTC00805)
Accession : NP_781466.1
Strain : Clostridium tetani E88
Genome accession: NC_004557
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 849627 - 850328 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
GTGAATAAAAATACTATCATTGTAGTAGATGATGAAAAAGAAATAAGGGACTTAATATGTATATATTTAGAAAATGAAGG
CTATAGAGTAATTAAAGCAGAAAATGGTATAAAAGCATTAGAATTATTAGAGAAAGAAAAGGTAGATTTAATAATACTTG
ATATAATGATGCCAAATATGGATGGAATTGAAGCATGTACTAAAATTAGAGAAGAAAAAAACATGCCTATAATAATGTTA
TCAGCTAAAACAGAAGATATGGATAAAATATGGGGACTTACTGCAGGAGCAGATGACTATATGACAAAACCATTTAACCC
TTTAGAACTTATAGCAAGGGTAAAATCTCAATTAAGAAGATATAAAAAGTTTAATGTTCAAAATGGTTATATTAATGATG
ATATAATAGAAATAGATGAACTTACAATTAATACCGCAACCCACGAGGTTCAGGTTGGAGAAAAAAAAGTTAGACTTACT
CCTAGAGAGTTTGATATATTAGAATTACTAGCTAGAAATAAAGGAATAGTATTTAGTATAGAAAAAATATATGAAAGAGT
TTGGAAAGAAGAGTTTTTTAAATCAGATAATACAGTTATGGTACACATAAGAAAACTAAGAGAAAAGATAGAGGAAAATC
CTAGAAAACCTAAGTATGTAAAGACTGTATGGGGTGTAGGCTATAAGGTAGAAAAGTTATAA

Protein sequence :
MNKNTIIVVDDEKEIRDLICIYLENEGYRVIKAENGIKALELLEKEKVDLIILDIMMPNMDGIEACTKIREEKNMPIIML
SAKTEDMDKIWGLTAGADDYMTKPFNPLELIARVKSQLRRYKKFNVQNGYINDDIIEIDELTINTATHEVQVGEKKVRLT
PREFDILELLARNKGIVFSIEKIYERVWKEEFFKSDNTVMVHIRKLREKIEENPRKPKYVKTVWGVGYKVEKL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 8e-25 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-38 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CTC00805 NP_781466.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-53 55
CTC00805 NP_781466.1 two-component response regulator AM180355.1.gene1830. Protein 3e-53 54
CTC00805 NP_781466.1 two-component response regulator NC_005054.2598277.p0 Protein 2e-56 54
CTC00805 NP_781466.1 two-component response regulator NC_014475.1.orf0.gen Protein 2e-56 54
CTC00805 NP_781466.1 two-component response regulator AF130997.1.orf0.gene Protein 5e-50 52
CTC00805 NP_781466.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-58 52
CTC00805 NP_781466.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-55 51
CTC00805 NP_781466.1 two-component response regulator AF162694.1.orf4.gene Protein 2e-52 50
CTC00805 NP_781466.1 two-component response regulator EU250284.1.orf4.gene Protein 3e-51 49
CTC00805 NP_781466.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_002758.1121668.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_009641.5332272.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_013450.8614421.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_007793.3914279.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_002745.1124361.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_009782.5559369.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator NC_002951.3237708.p0 Protein 4e-41 46
CTC00805 NP_781466.1 two-component response regulator HE999704.1.gene2815. Protein 9e-44 45
CTC00805 NP_781466.1 two-component response regulator NC_012469.1.7685629. Protein 6e-39 45
CTC00805 NP_781466.1 two-component response regulator CP001581.1.gene280.p Protein 1e-40 44
CTC00805 NP_781466.1 two-component response regulator NC_012469.1.7686381. Protein 4e-40 43
CTC00805 NP_781466.1 two-component response regulator AF253562.2.orf0.gene Protein 2e-35 42
CTC00805 NP_781466.1 two-component response regulator AE016830.1.gene1681. Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CTC00805 NP_781466.1 two-component response regulator VFG1702 Protein 3e-38 41
CTC00805 NP_781466.1 two-component response regulator VFG1563 Protein 8e-38 41