
|
Name : ECA2863 (ECA2863) Accession : YP_050954.1 Strain : Pectobacterium atrosepticum SCRI1043 Genome accession: NC_004547 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3203055 - 3203267 bp Length : 213 bp Strand : + Note : Similar to Shigella flexneri orf, conserved hypothetical protein AlpA or sf2987 SWALL:AAN44468 (EMBL:AE015312) (68 aa) fasta scores: E(): 3.4e-18, 78.68% id in 61 aa, and to Escherichia coli O6 conserved hypothetical protein c0306 SWALL:Q8FKT9 (EMBL:AE016 DNA sequence : ATGAGTACCGCTGCTGATTACCGCCTTATTAACGACCAGTTCGTCGATATGACCTTCATCACCCAGTTGACCGGATTAAC CGACAAATGGTTTTACAAGCTGATTCAACTGGGTGAATTCCCGAAGCCGATTAAGCTGGGCCGCCGTTCCCGCTGGCTGC AAAGTGAAGTCGAAACCTGGTTACAGCAACGTATCGATCAGTCTCGCCAGTAG Protein sequence : MSTAADYRLINDQFVDMTFITQLTGLTDKWFYKLIQLGEFPKPIKLGRRSRWLQSEVETWLQQRIDQSRQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 1e-19 | 78 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 8e-20 | 78 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-19 | 78 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-19 | 78 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-19 | 76 |
| unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 3e-19 | 71 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 4e-17 | 68 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 6e-17 | 68 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 4e-13 | 66 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 4e-13 | 66 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ECA2863 | YP_050954.1 | hypothetical protein | VFG0651 | Protein | 3e-20 | 78 |
| ECA2863 | YP_050954.1 | hypothetical protein | VFG1057 | Protein | 1e-19 | 71 |
| ECA2863 | YP_050954.1 | hypothetical protein | VFG1480 | Protein | 2e-17 | 68 |