Gene Information

Name : ECA2863 (ECA2863)
Accession : YP_050954.1
Strain : Pectobacterium atrosepticum SCRI1043
Genome accession: NC_004547
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3203055 - 3203267 bp
Length : 213 bp
Strand : +
Note : Similar to Shigella flexneri orf, conserved hypothetical protein AlpA or sf2987 SWALL:AAN44468 (EMBL:AE015312) (68 aa) fasta scores: E(): 3.4e-18, 78.68% id in 61 aa, and to Escherichia coli O6 conserved hypothetical protein c0306 SWALL:Q8FKT9 (EMBL:AE016

DNA sequence :
ATGAGTACCGCTGCTGATTACCGCCTTATTAACGACCAGTTCGTCGATATGACCTTCATCACCCAGTTGACCGGATTAAC
CGACAAATGGTTTTACAAGCTGATTCAACTGGGTGAATTCCCGAAGCCGATTAAGCTGGGCCGCCGTTCCCGCTGGCTGC
AAAGTGAAGTCGAAACCTGGTTACAGCAACGTATCGATCAGTCTCGCCAGTAG

Protein sequence :
MSTAADYRLINDQFVDMTFITQLTGLTDKWFYKLIQLGEFPKPIKLGRRSRWLQSEVETWLQQRIDQSRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 1e-19 78
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 8e-20 78
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-19 78
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-19 78
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-19 76
unnamed AAL08466.1 unknown Not tested SRL Protein 3e-19 71
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-17 68
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 4e-17 68
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 4e-13 66
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 4e-13 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECA2863 YP_050954.1 hypothetical protein VFG0651 Protein 3e-20 78
ECA2863 YP_050954.1 hypothetical protein VFG1057 Protein 1e-19 71
ECA2863 YP_050954.1 hypothetical protein VFG1480 Protein 2e-17 68