Gene Information

Name : ECA2855 (ECA2855)
Accession : YP_050946.1
Strain : Pectobacterium atrosepticum SCRI1043
Genome accession: NC_004547
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 3197249 - 3197722 bp
Length : 474 bp
Strand : -
Note : Similar to Shigella flexneri intergenic-region protein yees or sf2996 SWALL:AAN44477 (EMBL:AE015313) (163 aa) fasta scores: E(): 4.9e-27, 50.65% id in 152 aa, and to Escherichia coli intergenic-region protein SWALL:Q8VRA3 (EMBL:AF447814) (163 aa) fasta sc

DNA sequence : 
ATGTCATGTAATTCATTGGCAGGCCACGTTGCGTCCAGAGAGCAGCGCATTATCCAAATGGCGCTGTGCCTGCTGGAAAA
ACGCGTGCGTAAAAATGCGCGACAGTTCAAAACCTCTGAGGACACCAAAAGCTGGTTACTGCTGGAACTCAGCAGTCTGG
AGCGTGAAGTCTTTATGGTGCTGTATCTGGATAACCAGCATCGCCTGATAGAAAAAGAAGTTATCGCGCTGGGCGGCATC
AACAGTACCGAAGTACATCCGCGTGAAATCCTCAAAGCCTCACTGCGTCATAACGCCGCCGCCGTGATACTGGCACACAA
TCATCCTTCCGGCTGTGCCGAGCCCAGTCAGGCTGACCGCCATATCACCGACAAGCTGAAGGGATCACTGTCACAGCTCG
ACGTCAGAGTCCTCGATCATCTGGTTGTCGGCGGCGCTGAGGTAATGTCGTTTGCTGAACGTGGCTGGTTGTGA

Protein sequence : 
MSCNSLAGHVASREQRIIQMALCLLEKRVRKNARQFKTSEDTKSWLLLELSSLEREVFMVLYLDNQHRLIEKEVIALGGI
NSTEVHPREILKASLRHNAAAVILAHNHPSGCAEPSQADRHITDKLKGSLSQLDVRVLDHLVVGGAEVMSFAERGWL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 3e-27 56
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-27 55
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-27 55
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 5e-31 52
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 3e-29 51
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 3e-30 51
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 2e-29 51
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 4e-30 51
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 4e-30 51
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-30 51
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 2e-30 51
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 2e-30 51
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 1e-28 50
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 50
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 5e-29 50
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 3e-29 50
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 2e-29 50
unnamed AAL08475.1 unknown Not tested SRL Protein 2e-29 50
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 3e-29 50
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 3e-29 50
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 2e-29 50
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 2e-29 50
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 4e-24 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECA2855 YP_050946.1 hypothetical protein VFG1119 Protein 2e-27 55
ECA2855 YP_050946.1 hypothetical protein VFG1678 Protein 2e-31 52
ECA2855 YP_050946.1 hypothetical protein VFG0660 Protein 5e-31 51
ECA2855 YP_050946.1 hypothetical protein VFG1528 Protein 1e-29 50
ECA2855 YP_050946.1 hypothetical protein VFG1617 Protein 4e-29 50
ECA2855 YP_050946.1 hypothetical protein VFG1066 Protein 7e-30 50