Gene Information

Name : ECA2853 (ECA2853)
Accession : YP_050944.1
Strain : Pectobacterium atrosepticum SCRI1043
Genome accession: NC_004547
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3196485 - 3196805 bp
Length : 321 bp
Strand : -
Note : Similar to Shigella flexneri 2a hypothetical 14.0 kDa protein SWALL:Q9AL42 (EMBL:AF200692) (125 aa) fasta scores: E(): 1.5e-21, 58.65% id in 104 aa, and to Escherichia coli hypothetical protein ykfi or b0245 SWALL:YKFI_ECOLI (SWALL:P77692) (113 aa) fasta

DNA sequence :
ATGCAAACATCACCAGCAATCCCTCGACGGGAGGATAACCCCTGTCCGTCACCCATAGCCGCTTGGCAGCAACTTATGAC
CTACCTGCTGGAAAAGCACTACGGCCTGATGCTGAATGACACACCGTTCTGCGAGGAAAACGTGATTCAGGAACATATCG
ATGCTGGCATCACGTTGGTCAATGCCGTGAATTTTCTGGTGGAAAAATACGAACTGGTGCGTATCGACCGCGACGGTTTT
AACTGGCAGGAGCAATCACCGTTTCTCACTGCCGTTGATGTTCTCCGTGCTAGACGCGCAACAGGTTTACTTAAGGCATA
A

Protein sequence :
MQTSPAIPRREDNPCPSPIAAWQQLMTYLLEKHYGLMLNDTPFCEENVIQEHIDAGITLVNAVNFLVEKYELVRIDRDGF
NWQEQSPFLTAVDVLRARRATGLLKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 8e-28 59
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 8e-28 59
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 5e-28 59
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 2e-26 58
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 2e-26 58
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-26 58
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-26 58
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-27 58
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 3e-27 58
unnamed AAL57575.1 unknown Not tested LEE Protein 1e-27 58
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-27 58
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 9e-28 58
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 7e-27 57
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 6e-27 57
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 6e-27 57
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-26 57
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 6e-26 57
unnamed AAL08478.1 unknown Not tested SRL Protein 9e-26 56
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-26 56
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 3e-26 56
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 2e-26 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECA2853 YP_050944.1 hypothetical protein VFG0663 Protein 2e-28 59
ECA2853 YP_050944.1 hypothetical protein VFG0786 Protein 5e-27 58
ECA2853 YP_050944.1 hypothetical protein VFG1530 Protein 3e-27 57
ECA2853 YP_050944.1 hypothetical protein VFG1682 Protein 3e-26 57
ECA2853 YP_050944.1 hypothetical protein VFG1620 Protein 4e-27 57
ECA2853 YP_050944.1 hypothetical protein VFG1069 Protein 4e-26 56