Gene Information

Name : alpA (ECA1627)
Accession : YP_049728.1
Strain : Pectobacterium atrosepticum SCRI1043
Genome accession: NC_004547
Putative virulence/resistance : Virulence
Product : prophage regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1881018 - 1881212 bp
Length : 195 bp
Strand : -
Note : Similar to Escherichia coli prophage cp4-57 regulatory protein AlpA or Alp or b2624 SWALL:ALPA_ECOLI (SWALL:P33997) (70 aa) fasta scores: E(): 0.00017, 37.28% id in 59 aa, and to Yersinia pseudotuberculosis DNA-binding protein SWALL:Q9X9G5 (EMBL:AJ236887)

DNA sequence :
ATGACATCTCATCAGTTATTACGTCTGAAACAAGTTGAAGTAAAAACCGGTCTCAAGCGCTCGCAAGTTTATCTTTATAT
GAAAGAAGGTACCTTCCCCCGATCAATCAAGATTGGCCCGGCCAGCGTGGCCTGGCTCGAGTCTGAGATTGACGAATGGA
TCAACCTCAAATTAGCTAACCGCTTGATGCGCTGA

Protein sequence :
MTSHQLLRLKQVEVKTGLKRSQVYLYMKEGTFPRSIKIGPASVAWLESEIDEWINLKLANRLMR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 6e-21 91
unnamed CAA21398.1 - Not tested HPI Protein 1e-20 87
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 9e-21 87
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 4e-09 49
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 1e-11 48
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 1e-09 46
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 1e-09 46
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 1e-09 46
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 2e-09 41
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 2e-09 41
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 2e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
alpA YP_049728.1 prophage regulatory protein VFG1118 Protein 4e-10 46
alpA YP_049728.1 prophage regulatory protein VFG1141 Protein 6e-10 41