Name : alpA (ECA1627) Accession : YP_049728.1 Strain : Pectobacterium atrosepticum SCRI1043 Genome accession: NC_004547 Putative virulence/resistance : Virulence Product : prophage regulatory protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1881018 - 1881212 bp Length : 195 bp Strand : - Note : Similar to Escherichia coli prophage cp4-57 regulatory protein AlpA or Alp or b2624 SWALL:ALPA_ECOLI (SWALL:P33997) (70 aa) fasta scores: E(): 0.00017, 37.28% id in 59 aa, and to Yersinia pseudotuberculosis DNA-binding protein SWALL:Q9X9G5 (EMBL:AJ236887) DNA sequence : ATGACATCTCATCAGTTATTACGTCTGAAACAAGTTGAAGTAAAAACCGGTCTCAAGCGCTCGCAAGTTTATCTTTATAT GAAAGAAGGTACCTTCCCCCGATCAATCAAGATTGGCCCGGCCAGCGTGGCCTGGCTCGAGTCTGAGATTGACGAATGGA TCAACCTCAAATTAGCTAACCGCTTGATGCGCTGA Protein sequence : MTSHQLLRLKQVEVKTGLKRSQVYLYMKEGTFPRSIKIGPASVAWLESEIDEWINLKLANRLMR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 6e-21 | 91 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 1e-20 | 87 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 9e-21 | 87 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 4e-09 | 49 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 1e-11 | 48 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 46 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 46 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 46 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 41 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 41 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
alpA | YP_049728.1 | prophage regulatory protein | VFG1118 | Protein | 4e-10 | 46 |
alpA | YP_049728.1 | prophage regulatory protein | VFG1141 | Protein | 6e-10 | 41 |