Gene Information

Name : blr3121 (blr3121)
Accession : NP_769761.1
Strain : Bradyrhizobium japonicum USDA 110
Genome accession: NC_004463
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3445840 - 3446514 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
GTGCGCCTGCTCGTTGTTGAGGACGACCCCGATCTCAATCGCCAGCTCACCAAGGCGCTGACGGACGCCGGCTATGTCGT
CGACCGCGCCTTCGACGGGGAGGAGGGGCACTATCTCGGCGACAACGAGCCGTACGATGCCGTCGTACTCGACATCGGCC
TGCCGAAGAAGGACGGCATCTCGGTGCTGGAGGCCTGGCGCCGCAACGGCCGCACCATGCCGGTCCTGATCCTCACCGCG
CGCGACCGCTGGAGCGACAAGGTCCAGGGCTTCGATGCCGGCGCCGACGACTATGTCGCAAAGCCGTTCCATCTCGAGGA
GGTGCTGGCGCGCATCCGCGCGCTGCTGCGCCGTTCCACCGGCCATGCCCAGAGCGAACTCAGCTGCGGCCCGGTCACGC
TCGACACCAGGACCGGCCGGGTCAGCGTGTCCGGCAATCCCGTCAAGATGACCTCGCACGAATATCGGCTTCTGGCCTAC
CTGATGCACCATTCCGGACGCGTGGTCTCCCGCACCGAGCTGGTCGAGCATCTCTACGACCAGGACTTCGACCGCGACTC
CAACACCATCGAGGTCTTCGTCGGCCGTATTCGCAAGAAGCTCGACGTCGACATCATCCAGACCGTCCGCGGCCTCGGCT
ATCTCCTGACCCCGCCGCCCGCTCCGGGCGCCTGA

Protein sequence :
MRLLVVEDDPDLNRQLTKALTDAGYVVDRAFDGEEGHYLGDNEPYDAVVLDIGLPKKDGISVLEAWRRNGRTMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARIRALLRRSTGHAQSELSCGPVTLDTRTGRVSVSGNPVKMTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLDVDIIQTVRGLGYLLTPPPAPGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 6e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
blr3121 NP_769761.1 two-component response regulator NC_002516.2.879194.p Protein 1e-45 48
blr3121 NP_769761.1 two-component response regulator CP000647.1.gene1136. Protein 8e-42 46
blr3121 NP_769761.1 two-component response regulator BAC0530 Protein 7e-42 46
blr3121 NP_769761.1 two-component response regulator CP001918.1.gene2526. Protein 1e-40 45
blr3121 NP_769761.1 two-component response regulator BAC0487 Protein 2e-35 44
blr3121 NP_769761.1 two-component response regulator NC_002695.1.913289.p Protein 2e-41 44
blr3121 NP_769761.1 two-component response regulator CP000034.1.gene2022. Protein 8e-42 44
blr3121 NP_769761.1 two-component response regulator CP001138.1.gene1939. Protein 7e-42 44
blr3121 NP_769761.1 two-component response regulator CP004022.1.gene1005. Protein 4e-43 44
blr3121 NP_769761.1 two-component response regulator BAC0347 Protein 7e-34 42
blr3121 NP_769761.1 two-component response regulator BAC0125 Protein 1e-35 41
blr3121 NP_769761.1 two-component response regulator BAC0111 Protein 2e-37 41
blr3121 NP_769761.1 two-component response regulator BAC0638 Protein 8e-32 41
blr3121 NP_769761.1 two-component response regulator BAC0083 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
blr3121 NP_769761.1 two-component response regulator VFG0475 Protein 6e-42 44
blr3121 NP_769761.1 two-component response regulator VFG1390 Protein 4e-34 41
blr3121 NP_769761.1 two-component response regulator VFG0473 Protein 2e-33 41