Gene Information

Name : VV1_0386 (VV1_0386)
Accession : NP_759382.1
Strain :
Genome accession: NC_004459
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 367972 - 368268 bp
Length : 297 bp
Strand : -
Note : COG2963

DNA sequence :
ATGACAGGTGAAGCTATGACCAAGCGTACCAGACGCACTTTCAGTGCAGAATTTAAACTCGAAGCAGCACAGCTTGTGCT
CGACCAAAACTACACCGTTGTTGAAGCTGCAAAAGCCATGGGTGTCGGTAAATCGACAATGGACAAGTGGGTAAGGCAGC
TTAAGCAAGAAAGAAAGGGAGTCACTCCCCAAGCCGCACCTATGACACCAGAGCAAATTGAGATACGTGAGCTGAAGAAG
AAACTTGCACGCCTTGAAGAGCACAATGAAATATTAAAAAAGCTACAGCTCTCTTGA

Protein sequence :
MTGEAMTKRTRRTFSAEFKLEAAQLVLDQNYTVVEAAKAMGVGKSTMDKWVRQLKQERKGVTPQAAPMTPEQIEIRELKK
KLARLEEHNEILKKLQLS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-35 86
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-35 86
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-35 86
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-34 86
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-35 86
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-34 86
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-35 86
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-35 86
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-24 71
l7045 CAD33744.1 - Not tested PAI I 536 Protein 8e-25 71
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 8e-25 71
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-24 70
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 9e-21 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-24 57
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-24 56
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-24 56
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-25 56
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-25 56
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-25 56
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-19 54
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 47
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 4e-11 44
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VV1_0386 NP_759382.1 transposase VFG1123 Protein 3e-35 86
VV1_0386 NP_759382.1 transposase VFG1485 Protein 3e-25 71
VV1_0386 NP_759382.1 transposase VFG1553 Protein 4e-21 61
VV1_0386 NP_759382.1 transposase VFG0784 Protein 2e-25 56
VV1_0386 NP_759382.1 transposase VFG1566 Protein 1e-12 47
VV1_0386 NP_759382.1 transposase VFG1521 Protein 2e-11 44