Gene Information

Name : rpmE2 (c0407)
Accession : NP_752344.2
Strain : Escherichia coli CFT073
Genome accession: NC_004431
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0254
EC number : -
Position : 387632 - 387895 bp
Length : 264 bp
Strand : -
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGAAACCCAATATCCATCCTGAGTATCGTACTGTGGTGTTCCACGACACCAGCGTTGATGAGTACTTTAAAATCGGCTC
GACTATCAAAACAGACCGTGAGATTGAGCTGGATGGCGTAACGTATCCGTACGTAACAATTGATGTCTCTTCGAAATCGC
ACCCGTTCTATACAGGGAAGCTGAGAACAGTGGCATCAGAAGGAAATGTTGCACGGTTCACCCAACGTTTTGGTCGTTTT
GTTAGCACGAAAAAGGGGGCATGA

Protein sequence :
MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYVTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRF
VSTKKGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 2e-34 94
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 2e-34 94