Name : c0306 (c0306) Accession : NP_752250.1 Strain : Escherichia coli CFT073 Genome accession: NC_004431 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 282559 - 282765 bp Length : 207 bp Strand : - Note : Escherichia coli O157:H7 ortholog: z1627 DNA sequence : ATGACCACCCCAGTTTCGCTGATGGATGACCAGATGGTCGATATGACGTTTATCACTCAGCTGACCGGCCTGACCGATAA GTGGTTTTACAAGCTCATCAAGGATGGGGCCTTTCCGGCACCCATCAAACTCGGCCGCAGCTCCCGCTGGCTGAAAAGTG AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA Protein sequence : MTTPVSLMDDQMVDMTFITQLTGLTDKWFYKLIKDGAFPAPIKLGRSSRWLKSEVEAWLQARIAQSRP |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 7e-27 | 99 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-26 | 95 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 3e-26 | 95 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-26 | 95 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 5e-26 | 95 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 5e-26 | 95 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 8e-26 | 93 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 4e-26 | 93 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-14 | 70 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-14 | 70 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 6e-18 | 70 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-18 | 70 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
c0306 | NP_752250.1 | hypothetical protein | VFG0651 | Protein | 1e-26 | 95 |
c0306 | NP_752250.1 | hypothetical protein | VFG1057 | Protein | 1e-26 | 93 |
c0306 | NP_752250.1 | hypothetical protein | VFG1480 | Protein | 2e-18 | 70 |