Name : rpmG (CE0942) Accession : NP_737552.1 Strain : Corynebacterium efficiens YS-314 Genome accession: NC_004369 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 1004775 - 1004939 bp Length : 165 bp Strand : - Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCACGTAATGATATCCGCCCCATCATCAAGCTGAAGTCTACGGCTGGCACCGGTTACACCTATGTCACCCGCAAGAA CAAGCGCAACAACCCGGACCGTATCACCCTCAAGAAGTTCGATCCGGTTATCCGCAAGCACGTCGAATTCCGCGAGGAGC GATAA Protein sequence : MARNDIRPIIKLKSTAGTGYTYVTRKNKRNNPDRITLKKFDPVIRKHVEFREER |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 6e-05 | 45 |
rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 9e-05 | 45 |