Gene Information

Name : SF2036 (SF2036)
Accession : NP_707872.1
Strain : Shigella flexneri 301
Genome accession: NC_004337
Putative virulence/resistance : Unknown
Product : ISSfl4 ORF2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2059296 - 2059643 bp
Length : 348 bp
Strand : -
Note : Code: L; COG: COG3436

DNA sequence :
ATGATAACGCTGCCGACCGGTACCAAAATCTGGATCATCGCTGGCATCACAGATATGCGTTGTGGCTTCAATGGCCTGGC
TTCGAAGGTGCAGAACACGCTGAAAGATGACCCGTTCTCCGGGCATATCTTCGTCTTCCGGGGCCGCAGTGGCAAAATGG
TGAAAATACTGTGGGCCGATCGTGACGGGTTATGCCTGTTCGCCAAACTCCTGGAACGGGGCCGCTTCGTCTGGCCGGTG
ACCCGGGAAGGGAAAGTGCACCTGACGCCAGCTCAGTTATCCATGCTACTGGAGGGGATCGCGTGGCAACATCCCAAACG
GACAGAACGGCCTGGCATCCGGATATAA

Protein sequence :
MITLPTGTKIWIIAGITDMRCGFNGLASKVQNTLKDDPFSGHIFVFRGRSGKMVKILWADRDGLCLFAKLLERGRFVWPV
TREGKVHLTPAQLSMLLEGIAWQHPKRTERPGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-49 98
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-49 98
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-44 81
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-44 81
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-44 80
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-37 73
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-37 73
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-36 72
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-36 72
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-36 72
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-36 72
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-36 72
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-36 72
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-36 72
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-36 72
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-35 72
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-35 72
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-36 72
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-27 71
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-30 62
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 9e-33 61
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 9e-33 61
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-34 60
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-34 60
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-33 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SF2036 NP_707872.1 ISSfl4 ORF2 VFG1665 Protein 2e-44 80
SF2036 NP_707872.1 ISSfl4 ORF2 VFG1698 Protein 2e-37 73
SF2036 NP_707872.1 ISSfl4 ORF2 VFG0792 Protein 7e-37 72
SF2036 NP_707872.1 ISSfl4 ORF2 VFG1052 Protein 1e-36 72
SF2036 NP_707872.1 ISSfl4 ORF2 VFG1709 Protein 7e-37 72
SF2036 NP_707872.1 ISSfl4 ORF2 VFG1517 Protein 5e-28 71
SF2036 NP_707872.1 ISSfl4 ORF2 VFG1737 Protein 3e-34 59