Gene Information

Name : SF1908 (SF1908)
Accession : NP_707756.1
Strain : Shigella flexneri 301
Genome accession: NC_004337
Putative virulence/resistance : Unknown
Product : IS911 ORF1
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1944825 - 1945163 bp
Length : 339 bp
Strand : -
Note : Code: L; COG: COG2963

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGAAATACACGGTGGCAGATGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAACACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGT
GAGCTCAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTC
CCTGAACAGTTCTCGATAA

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIR
ELRKKLQRIEMENEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-41 98
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-41 98
api80 CAF28554.1 putative transposase Not tested YAPI Protein 6e-35 95
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-39 94
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-34 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 72
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-34 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-34 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-30 72
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-26 60
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-26 60
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-22 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-25 58
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-25 58
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-25 58
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-22 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 5e-21 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-20 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SF1908 NP_707756.1 IS911 ORF1 VFG1485 Protein 1e-41 98
SF1908 NP_707756.1 IS911 ORF1 VFG1123 Protein 1e-34 72
SF1908 NP_707756.1 IS911 ORF1 VFG1553 Protein 3e-30 72
SF1908 NP_707756.1 IS911 ORF1 VFG0784 Protein 2e-25 58
SF1908 NP_707756.1 IS911 ORF1 VFG1566 Protein 5e-13 42