Gene Information

Name : OB3452 (OB3452)
Accession : NP_694374.1
Strain : Oceanobacillus iheyensis HTE831
Genome accession: NC_004193
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3589404 - 3590105 bp
Length : 702 bp
Strand : -
Note : CDS_ID OB3452

DNA sequence :
ATGAGTCAAAAAATACTAGTAGTAGATGATGAGCAGCCAATTGCAGATATATTACAATTTAACTTAGAAAAAGAAGGCTA
CCAAGTTGTCGTAGCGAATGATGGAGATACAGCAATAGAATTAGCAGAAAGTGAAAAACCGAACCTAATTCTGTTAGATA
TTATGCTTCCGGGAAAAGACGGGAATGAAGTATTAAGAGAAGTAAGAAAAACACAAAACATACCTGTAATCATGCTTACA
GCAAAAGATGCAGAAATCGATAAAGTATTAGGACTGGAGCTTGGTGCGGATGATTACGTAACAAAGCCATTTAGTAATCG
AGAGCTTATTGCACGTGTTAAGGCGAATTTACGTCGTGAACAAGTACCTGATGAAACAGTGAAAACAACCAAAGACATCG
TTATTGGTGATCTTATCGTACACCCTGATGCGTATGTTGTATCGCGAAAAGGCGAAGAAATTGAGCTTACCCATCGTGAG
TTCGAGCTTCTACATTATCTGGCGCGTCATATAGGACAAGTAATGACAAGAGAACATCTATTAGAAACCGTATGGGGATA
TGATTATTTCGGTGATGTGCGTACAGTTGATGTGACTGTCCGTCGTCTTCGTGAAAAAATTGAAGAAAACCCAAGTAATC
CTTTATGGATTGTGACCCGAAGAGGTGTGGGCTATTATTTACGTAATCCTGAGCAGGAGTAG

Protein sequence :
MSQKILVVDDEQPIADILQFNLEKEGYQVVVANDGDTAIELAESEKPNLILLDIMLPGKDGNEVLREVRKTQNIPVIMLT
AKDAEIDKVLGLELGADDYVTKPFSNRELIARVKANLRREQVPDETVKTTKDIVIGDLIVHPDAYVVSRKGEEIELTHRE
FELLHYLARHIGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEENPSNPLWIVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OB3452 NP_694374.1 two-component response regulator NC_012469.1.7685629. Protein 6e-63 67
OB3452 NP_694374.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-54 56
OB3452 NP_694374.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-54 56
OB3452 NP_694374.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-54 56
OB3452 NP_694374.1 two-component response regulator HE999704.1.gene2815. Protein 1e-50 55
OB3452 NP_694374.1 two-component response regulator NC_012469.1.7686381. Protein 3e-42 50
OB3452 NP_694374.1 two-component response regulator AE016830.1.gene1681. Protein 2e-46 48
OB3452 NP_694374.1 two-component response regulator HE999704.1.gene1528. Protein 1e-30 45
OB3452 NP_694374.1 two-component response regulator AF162694.1.orf4.gene Protein 8e-35 45
OB3452 NP_694374.1 two-component response regulator AE000516.2.gene3505. Protein 4e-35 45
OB3452 NP_694374.1 two-component response regulator EU250284.1.orf4.gene Protein 5e-35 44
OB3452 NP_694374.1 two-component response regulator CP001918.1.gene5135. Protein 1e-29 44
OB3452 NP_694374.1 two-component response regulator FJ349556.1.orf0.gene Protein 9e-37 44
OB3452 NP_694374.1 two-component response regulator CP001485.1.gene721.p Protein 6e-28 43
OB3452 NP_694374.1 two-component response regulator CP001138.1.gene4273. Protein 7e-33 43
OB3452 NP_694374.1 two-component response regulator AM180355.1.gene1830. Protein 6e-34 43
OB3452 NP_694374.1 two-component response regulator CP004022.1.gene3215. Protein 7e-36 43
OB3452 NP_694374.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-36 43
OB3452 NP_694374.1 two-component response regulator NC_007622.3794948.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_003923.1003417.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_013450.8614146.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_002951.3238224.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_007793.3914065.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_002758.1121390.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_010079.5776364.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator NC_002952.2859858.p0 Protein 8e-33 43
OB3452 NP_694374.1 two-component response regulator AE015929.1.gene1106. Protein 2e-29 43
OB3452 NP_694374.1 two-component response regulator BAC0308 Protein 3e-27 42
OB3452 NP_694374.1 two-component response regulator BAC0125 Protein 5e-30 42
OB3452 NP_694374.1 two-component response regulator AF130997.1.orf0.gene Protein 3e-29 42
OB3452 NP_694374.1 two-component response regulator NC_002695.1.915041.p Protein 2e-33 42
OB3452 NP_694374.1 two-component response regulator BAC0533 Protein 7e-33 42
OB3452 NP_694374.1 two-component response regulator CP000034.1.gene3834. Protein 2e-33 42
OB3452 NP_694374.1 two-component response regulator CP000647.1.gene4257. Protein 7e-33 42
OB3452 NP_694374.1 two-component response regulator BAC0197 Protein 1e-29 42
OB3452 NP_694374.1 two-component response regulator CP000647.1.gene2531. Protein 1e-30 42
OB3452 NP_694374.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-33 41
OB3452 NP_694374.1 two-component response regulator CP004022.1.gene1676. Protein 2e-28 41
OB3452 NP_694374.1 two-component response regulator BAC0039 Protein 1e-30 41
OB3452 NP_694374.1 two-component response regulator NC_002695.1.916589.p Protein 1e-30 41
OB3452 NP_694374.1 two-component response regulator CP001138.1.gene2239. Protein 1e-29 41
OB3452 NP_694374.1 two-component response regulator CP000034.1.gene2186. Protein 1e-30 41
OB3452 NP_694374.1 two-component response regulator BAC0596 Protein 1e-29 41
OB3452 NP_694374.1 two-component response regulator NC_010410.6002907.p0 Protein 4e-25 41
OB3452 NP_694374.1 two-component response regulator NC_011586.7046392.p0 Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OB3452 NP_694374.1 two-component response regulator VFG0596 Protein 4e-30 43
OB3452 NP_694374.1 two-component response regulator VFG1563 Protein 1e-34 42
OB3452 NP_694374.1 two-component response regulator VFG1702 Protein 7e-35 42
OB3452 NP_694374.1 two-component response regulator VFG1389 Protein 3e-28 42