Gene Information

Name : merR-2 (SAG2024)
Accession : NP_689010.1
Strain : Streptococcus agalactiae 2603V/R
Genome accession: NC_004116
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2000549 - 2000941 bp
Length : 393 bp
Strand : -
Note : identified by match to PFAM protein family HMM PF00376

DNA sequence :
ATGATTTATCGCATTAGTGAGTTTGCAGATAAATGTGGAGTTAATAAAGAAACGATCAGATATTACGAGCGAAAAAATTT
ATTACAAGAACCTCACCGAACGGAAGCTGGTTATCGGATATATTCATATGATGACGTTAAGCGTGTTGGGTTTATTAAAC
GAATACAGGAACTTGGTTTCTCTTTAAGCGAGATTTATAAATTACTTGGTGTTGTAGATAAAGATGAAGTTCGTTGTCAA
GATATGTTCGAATTTGTTTCTAAAAAACAAAAGGAAGTGCAAAAACAAATAGAGGATTTAAAACGAATTGAAACTATGTT
AGACGACTTAAAACAACGATGTCCAGATGAAAAGAAATTACATTCGTGTCCAATAATAGAAACATTAACATGA

Protein sequence :
MIYRISEFADKCGVNKETIRYYERKNLLQEPHRTEAGYRIYSYDDVKRVGFIKRIQELGFSLSEIYKLLGVVDKDEVRCQ
DMFEFVSKKQKEVQKQIEDLKRIETMLDDLKQRCPDEKKLHSCPIIETLT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 1e-34 57
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 2e-34 57
merR ACK44535.1 MerR Not tested SGI1 Protein 9e-20 44
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 9e-20 44
merR AFG30124.1 MerR Not tested PAGI-2 Protein 9e-20 44
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-20 44
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-19 44
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-20 44
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 6e-20 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 9e-20 43
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0682 Protein 4e-39 66
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0680 Protein 5e-35 56
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0688 Protein 2e-20 44
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0232 Protein 9e-20 42
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0684 Protein 9e-20 42
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0686 Protein 2e-19 42
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0687 Protein 9e-20 42
merR-2 NP_689010.1 mercuric resistance operon regulatory protein MerR BAC0683 Protein 3e-19 42