Gene Information

Name : tll2364 (tll2364)
Accession : NP_683154.1
Strain : Thermosynechococcus elongatus BP-1
Genome accession: NC_004113
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2468192 - 2468947 bp
Length : 756 bp
Strand : -
Note : -

DNA sequence :
GTGTCCGTTACTTTGGAGACCCACAAGGAAAAGATACTCGTTGTTGACGATGAAGCGAGTATTCGTCGCATCTTAGAAAC
TCGCCTGTCAATGATTGGCTATACCGTCGTCACTGCCGCCGATGGCGAGGAAGCCCTGACCAAATTTCGGCAGGAGCAGC
CAGATTTAGTCGTGCTTGATGTGATGATGCCGAAACTAGACGGCTATGGCGTCTGTCAAGAACTGCGCAAGGAATCGGAT
GTCCCCATTATTATGCTCACTGCCCTGGGCGATGTGGCCGATCGCATTACGGGGCTAGAACTAGGTGCCGATGATTATGT
GGTCAAGCCCTTTTCCCCCAAGGAGTTGGAAGCCCGCATACGCTCGGTACTGCGACGCATTGAGAAAACCAGTACCTCTG
GCATCCCTAGCTCCGGGGTGATTCAGGTGGGCAATATTCGCATTGACACCAATAAGCGGCAGGTCTACAAGGGGGATGAG
CGCATTCGTCTCACGGGCATGGAATTTATGCTCTTGGAATTGCTGGTGGGACGCTCGGGCGAGCCTTTCTCCCGTGCAGA
AATTCTGGAGCAAGTATGGGGGTACACCCCCGAGCGCCATGTGGATACACGGGTGGTGGATGTCCACATTTCCCGCTTGC
GGGCTAAATTAGAAGAAGACCCCAGTAATCCAGAATTAATCTTGACCGCACGGGGTACTGGGTATCTCTTTCAGCGCATT
ACGGAACCGGGAGAAGCAAGCAACAAAAATCAATAG

Protein sequence :
MSVTLETHKEKILVVDDEASIRRILETRLSMIGYTVVTAADGEEALTKFRQEQPDLVVLDVMMPKLDGYGVCQELRKESD
VPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRIEKTSTSGIPSSGVIQVGNIRIDTNKRQVYKGDE
RIRLTGMEFMLLELLVGRSGEPFSRAEILEQVWGYTPERHVDTRVVDVHISRLRAKLEEDPSNPELILTARGTGYLFQRI
TEPGEASNKNQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tll2364 NP_683154.1 two-component response regulator NC_002745.1124361.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_009782.5559369.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_002951.3237708.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_002758.1121668.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_003923.1003749.p0 Protein 6e-48 50
tll2364 NP_683154.1 two-component response regulator NC_009641.5332272.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_013450.8614421.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_007793.3914279.p0 Protein 7e-48 50
tll2364 NP_683154.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-48 50
tll2364 NP_683154.1 two-component response regulator NC_012469.1.7685629. Protein 2e-43 47
tll2364 NP_683154.1 two-component response regulator HE999704.1.gene2815. Protein 5e-41 47
tll2364 NP_683154.1 two-component response regulator AE000516.2.gene3505. Protein 2e-43 46
tll2364 NP_683154.1 two-component response regulator BAC0125 Protein 2e-38 45
tll2364 NP_683154.1 two-component response regulator CP000034.1.gene3671. Protein 5e-39 44
tll2364 NP_683154.1 two-component response regulator BAC0083 Protein 4e-36 43
tll2364 NP_683154.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-36 42
tll2364 NP_683154.1 two-component response regulator CP004022.1.gene3215. Protein 9e-34 42
tll2364 NP_683154.1 two-component response regulator CP000675.2.gene1535. Protein 7e-39 42
tll2364 NP_683154.1 two-component response regulator BAC0197 Protein 4e-34 42
tll2364 NP_683154.1 two-component response regulator AE016830.1.gene1681. Protein 5e-40 42
tll2364 NP_683154.1 two-component response regulator BAC0638 Protein 2e-28 41
tll2364 NP_683154.1 two-component response regulator HE999704.1.gene1528. Protein 6e-30 41
tll2364 NP_683154.1 two-component response regulator CP001918.1.gene5135. Protein 2e-24 41
tll2364 NP_683154.1 two-component response regulator NC_012469.1.7686381. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tll2364 NP_683154.1 two-component response regulator VFG1389 Protein 3e-33 45
tll2364 NP_683154.1 two-component response regulator VFG1390 Protein 1e-39 43
tll2364 NP_683154.1 two-component response regulator VFG0596 Protein 5e-32 42