Gene Information

Name : terE (y0560)
Accession : NP_667897.1
Strain : Yersinia pestis KIM
Genome accession: NC_004088
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 626618 - 627193 bp
Length : 576 bp
Strand : +
Note : residues 1 to 191 of 191 are 85.34 pct identical to residues 1 to 191 of 191 from GenPept : >gb|AAG55730.1|AE005310_6 (AE005310) phage inhibition, colicin resistance and tellurite resistance protein [Escherichia coli O157:H7 EDL933]

DNA sequence :
ATGGCAGTTTCTCTGGTAAAAGGTGGTAACGTATCTCTGACAAAAGAAGCTCCAACCATGAACATTGCTGTCGTGGGGCT
GGGTTGGGATGCACGTGTGACCGATGGTTCTGAATTTGACCTTGATGCCTCGGTATTTATGGTCGGTGAAAACGGCAAAG
TTTTGTCTGATCAGCACTTCATCTTCTTTAACAACAAAGTGAGTCCTTGTGGTTCTGTTGTTCATCAGGGTGATAACCGT
ACCGGTGCTGGTGACGGTGACGATGAGCAGATCAAAATTGATCTGAAAAAAGTCCCAGCTGACGTGAAGAAAATTATTTT
CTCAGTCACCATTTATGATGCTGAAGCCCGTAAGCAAAACTTTGGTATGGTCAGCAACAGCTTCATGCGTGTGGTCAACG
AAGATAACAGCGCAGAAATTGCTCGCTTTGACCTATCCGAGGATGCCAGTACTGAAACCGCCATGATCTTTGGCGAGCTA
TACCGCAATAATGACGAATGGAAATTTAAAGCTGTCGGTCAGGGTTTTGCCGGTGGTCTGTCTGCGCTGGCAAGCCAGCA
TGGTGTGTCGGTATAA

Protein sequence :
MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASVFMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNR
TGAGDGDDEQIKIDLKKVPADVKKIIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGEL
YRNNDEWKFKAVGQGFAGGLSALASQHGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-74 86
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-74 86
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-74 86
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-63 71
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE NP_667897.1 tellurium resistance protein BAC0390 Protein 2e-74 81
terE NP_667897.1 tellurium resistance protein BAC0389 Protein 2e-58 65