Gene Information

Name : BA_0401 (BA_0401)
Accession : NP_842945.1
Strain : Bacillus anthracis Ames
Genome accession: NC_003997
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 419183 - 419767 bp
Length : 585 bp
Strand : +
Note : similar to SP:P33162; identified by sequence similarity

DNA sequence :
ATGGTTATTCAATTGCAAAAAGGACAGAAGATTGATTTAGGTAAGACAAGCCCTGGTTTAACAAAAGCAGTAATTGGTCT
TGGATGGGATATTAAATCTTATGACGGTGGATCAGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATGCGAACGGAA
AATGTACGAAGGAAACTGATTTTATCTTCTATAACAATTTACAGTCTCCTTGTGGATCTGTTCTACATACAGGAGATAAC
CGCACAGGTGAAGGTGAAGGTGAAGGCGACGATGAGCAACTTGTTGTAGATTTGAAGAAAGTTCCAGCAGATGTGCATAG
AATTGCTATTACAGTTACGATTTATGATGCGGAAGGCCGTAGTCAAAACTTTGGACAAGTAGGAAATGCGTTCGTTCGTT
TAGCGAATGAAGAAACGAATGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATTGAAACAGCAGTTGTCTTT
TGTGAATTATACCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGCGGATTCCAAGGTGGTTTAGGTGCGCTTGT
AAGAGCGTATGGCTTGGATGCATAA

Protein sequence :
MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDASAFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGEGDDEQLVVDLKKVPADVHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVF
CELYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-43 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-38 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-39 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-39 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-37 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-36 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-36 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-35 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BA_0401 NP_842945.1 tellurium resistance protein BAC0389 Protein 6e-39 57
BA_0401 NP_842945.1 tellurium resistance protein BAC0390 Protein 1e-37 51