Gene Information

Name : set24 (MW0390)
Accession : NP_645207.1
Strain : Staphylococcus aureus MW2
Genome accession: NC_003923
Putative virulence/resistance : Virulence
Product : superantigen-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 438308 - 439006 bp
Length : 699 bp
Strand : +
Note : exotoxin homolog; these proteins share structural homology to known superantigen proteins but do not exhibit any of the properties expected such as histocompatibility complex class II binding or broad T-cell activation

DNA sequence : 
ATGAAATTTACAGCATTAGCAAAAGCAACATTAGCATTAGGAATATTAACTACAGGTGTGTTTACAACAGAAAGTAAAGC
TGTTCACGCGAAAGTAGAACTTGATGAGACACAACGCAAATATTATATCAATATGCTACATCAATACTATTCTGAAGAAA
GTTTTGAACCAACAAATATTAGTGTTAAAAGCGAAGATTACTATGGCTCTAACGTTTTAAACTTTAAACAACGAAATAAA
GCTTTTAAAGTATTTTTACTTGGTGACGATAAAAATAAATATAAAGAAAAAACACATGGCCTTGATGTCTTTGCAGTACC
TGAATTAATAGATATAAAAGGTGGCATATATAGCGTTGGCGGTATAACAAAGAAAAATGTGAGATCAGTGTTTGGATTTG
TAAGTAATCCAAGTCTACAAGTTAAAAAAATCGATCCTAAACATGGCTTTTCGATAAATGAGTTGTTCTTTATTCAAAAG
GAAGAAGTATCGTTGAAGGAACTGGATTTTAAAATAAGAAAAATGTTAGTCGAAAAATATAGATTGTATAAAGGCGCGTC
AGATAAAGGTAGAATCGTTATTAATATGAAAGACGAAAAGAAATATGTAATTGATTTAAGTGAAAAATTAAGTTTTGATC
GTATGTTTGATGTAATGGATAGTAAGCAAATTAAAAATATTGAAGTGAATTTGAATTAA

Protein sequence : 
MKFTALAKATLALGILTTGVFTTESKAVHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK
AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKIDPKHGFSINELFFIQK
EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAS0392 YP_042517.1 superantigen-like protein Virulence vSa¥á Protein 4e-96 100
set24 NP_645207.1 superantigen-like protein Virulence vSa¥á Protein 4e-96 100
set13 NP_370952.1 superantigen-like protein Virulence vSa¥á Protein 2e-94 98
set13 NP_373639.1 superantigen-like protein Virulence vSa¥á Protein 2e-94 98
SAKOR_00412 YP_008490596.1 Exotoxin Virulence vSa¥á Protein 9e-93 96
SACOL0473 YP_185363.1 superantigen-like protein Virulence vSa¥á Protein 8e-92 94
set9nm YP_001331430.1 superantigen-like protein Virulence vSa¥á Protein 8e-92 94
SAUSA300_0403 YP_493117.1 superantigen-like protein Virulence vSa¥á Protein 8e-92 94
set5 YP_039881.1 superantigen-like protein Virulence vSa¥á Protein 4e-85 88
set12 NP_373638.1 superantigen-like protein Virulence vSa¥á Protein 4e-64 66
SAS0391 YP_042516.2 superantigen-like protein Virulence vSa¥á Protein 2e-63 66
set23 NP_645206.1 superantigen-like protein Virulence vSa¥á Protein 2e-63 66
set8nm YP_001331429.2 superantigen-like protein Virulence vSa¥á Protein 5e-64 66
SAUSA300_0402 YP_493116.1 superantigen-like protein Virulence vSa¥á Protein 5e-64 66
set12 NP_370951.1 superantigen-like protein Virulence vSa¥á Protein 4e-64 66
SAKOR_00411 YP_008490595.1 Exotoxin Virulence vSa¥á Protein 7e-64 66
set11 NP_370950.1 superantigen-like protein 7 Virulence vSa¥á Protein 2e-37 55
set11 NP_373637.1 superantigen-like protein 7 Virulence vSa¥á Protein 2e-37 55
set7nm YP_001331428.1 superantigen-like protein 7 Virulence vSa¥á Protein 5e-41 54
SAUSA300_0401 YP_493115.1 superantigen-like protein 7 Virulence vSa¥á Protein 5e-41 54
SAKOR_00410 YP_008490594.1 Exotoxin Virulence vSa¥á Protein 2e-43 54
SAMSHR1132_03760 YP_005324898.1 exotoxin 1 Virulence vSa¥á Protein 8e-43 53
SAS0390 YP_042515.1 superantigen-like protein 7 Virulence vSa¥á Protein 3e-39 52
set22 NP_645205.1 superantigen-like protein 7 Virulence vSa¥á Protein 3e-39 52
set1 YP_039880.1 superantigen-like protein 7 Virulence vSa¥á Protein 2e-42 50
set4 YP_039882.1 superantigen-like protein Virulence vSa¥á Protein 2e-28 47
SAMSHR1132_03770 YP_005324899.1 exotoxin 4 Virulence vSa¥á Protein 5e-26 46
SAS0393 YP_042518.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
set25 NP_645208.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
SACOL0474 YP_185364.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
set14 NP_370953.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
set14 NP_373640.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
set10nm YP_001331431.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
SAUSA300_0404 YP_493118.1 superantigen-like protein Virulence vSa¥á Protein 6e-27 44
SAKOR_00413 YP_008490597.1 Exotoxin Virulence vSa¥á Protein 7e-27 44