|
Name : rpmE2 (XAC3389) Accession : NP_643696.1 Strain : Xanthomonas axonopodis 306 Genome accession: NC_003919 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 3995796 - 3996038 bp Length : 243 bp Strand : - Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAAGATAACGTTCATCCCAACTACAAAGACGTCGTCTTTCACGACGTGACGTCCGATTTCAAGATTCTGACCCGTTC CACCATGACCTCGAAAGAGACCGTGAAGTGGGAAGACGGCCAGGAATATCCGCTAATCAAGGTGGAAATTTCCTCGTCCT CGCACCCGTTCTATACCGGCAAGCACAAGGTGATCGACACCGGCGGCCGTATCGACAAGTTCCAGAAGCGCTACGCGCGC TGA Protein sequence : MKDNVHPNYKDVVFHDVTSDFKILTRSTMTSKETVKWEDGQEYPLIKVEISSSSHPFYTGKHKVIDTGGRIDKFQKRYAR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-12 | 41 |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-12 | 41 |
