Gene Information

Name : BCE_0515 (BCE_0515)
Accession : NP_976842.1
Strain : Bacillus cereus ATCC 10987
Genome accession: NC_003909
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 527190 - 527768 bp
Length : 579 bp
Strand : +
Note : identified by match to protein family HMM PF02342

DNA sequence :
ATGGCTATTCAGTTACAAAAAGGACAGAAAATCGATTTAGGTAAAACAAGCCCTGGCTTAACAAAAGCAGTAATTGGTCT
TGGGTGGGATATTAAGTCTTATGATGGTGGAGCTGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATATGAACGGAA
AATGTACGAAGGAAACTGATTTTATTTTCTATAATAATTTACAGTCTCCTTGTGGATCAGTTTTACATACAGGTGATAAC
CGAACGGGTGAAGGTGAAGGCGACGATGAGCAACTTGTTGTAGATTTGAAGAAAGTTCCAGCAGATGTGCACAAAATTGC
TATTACAGTTACGATTTATGATGCGGAAGGTCGTAGTCAAAACTTTGGACAAGTAGGAAATGCTTTCGTTCGTTTAGCAA
ATGAAGAAACGAATGAAGAAGTTCTTCGCTTCGATTTAGGGGAAGATTTCTCTATCGAAACAGCAGTTGTCTTTTGTGAA
TTATATCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGTGGATTCCAAGGTGGTTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAG

Protein sequence :
MAIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDASAFLLDMNGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHKIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-47 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-43 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-44 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-44 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-42 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-39 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCE_0515 NP_976842.1 tellurium resistance protein BAC0389 Protein 4e-44 58
BCE_0515 NP_976842.1 tellurium resistance protein BAC0390 Protein 1e-42 54