Gene Information

Name : SCF56.25; terD (SCO0641)
Accession : NP_733509.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 681960 - 682535 bp
Length : 576 bp
Strand : +
Note : SCF56.25, terD, tellurium resistance protein (partial CDS), len: >185 aa; highly similar to SW:TERD_SERMA (EMBL:L38824) Serratia marcescens tellurium resistance protein TerD, 192 aa; fasta scores: opt: 876 z-score: 1043.0 E(): 0; 70.3% identity in 185 aa

DNA sequence :
GTGGGAGTTTCCCTGGCCAAGGGCGGCAACGTCTCGCTCAGCAAGGAGGCGCCCGGCCTGACCGCCGTGCTGGTGGGTCT
GGGCTGGGACGTGCGCACCACGACCGGCACCGACTACGACCTGGACGCCTCGGCGCTGCTCCTCGACACGTCGGGCAAGG
TGCTCTCGGACGGGCACTTCGTCTTCTACAACAACCTCACCAGCCCGGACGGGTCGGTCGAGCACACCGGCGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGCGGTCAAGGTGAACCTCGTCGCGGTCCCGGCCGAGGTGGACCGGATCGTCTT
CCCCGTCTCGATCCACGACGCGGAGAACCGCGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTTCATCCGGGTCGTCAACC
AGGCGAACAACCAGGAACTCGCCCGCTACGACCTGTCCGAGGACGCCTCGACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGGCACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGGCAGGGCTACGCCTCGGGTCTCGCCGGGATCGCCGCGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLAKGGNVSLSKEAPGLTAVLVGLGWDVRTTTGTDYDLDASALLLDTSGKVLSDGHFVFYNNLTSPDGSVEHTGDNL
TGEGEGDDEAVKVNLVAVPAEVDRIVFPVSIHDAENRGQSFGQVRNAFIRVVNQANNQELARYDLSEDASTETAMVFGEL
YRHGAEWKFRAVGQGYASGLAGIAADFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 70
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-57 69
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-54 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-54 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-54 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-53 65
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-24 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-24 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCF56.25; terD NP_733509.1 tellurium resistance protein BAC0389 Protein 2e-56 68
SCF56.25; terD NP_733509.1 tellurium resistance protein BAC0390 Protein 1e-57 66
SCF56.25; terD NP_733509.1 tellurium resistance protein BAC0392 Protein 3e-24 42