Name : rpmG (SCO4635) Accession : NP_628796.1 Strain : Streptomyces coelicolor A3(2) Genome accession: NC_003888 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 5061599 - 5061763 bp Length : 165 bp Strand : + Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : GTGGCTGCCACCGACGTCCGCCCGAAGATCACGCTGGCCTGCGTGGAGTGCAAGGAGCGGAACTACATCACCAAGAAGAA CCGGCGTAACAACCCGGACCGACTGGAGATGAAGAAGCACTGCCCGCGTTGCAACGCGCACACCGCGCACCGCGAAACGC GATAG Protein sequence : MAATDVRPKITLACVECKERNYITKKNRRNNPDRLEMKKHCPRCNAHTAHRETR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 2e-06 | 45 |
ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 1e-06 | 45 |