Gene Information

Name : SCD95A.10c (SCO4277)
Accession : NP_628449.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4692883 - 4693458 bp
Length : 576 bp
Strand : -
Note : SCD95A.10c, possible tellurium resistance protein, len: 191 aa; highly similar to many tellurium resistance related proteins, e.g. SW:TERE_SERMA (EMBL:L38824) Serratia marcescens tellurium resistance protein TerE, 191 aa; fasta scores: opt: 864 z-score: 1

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCTCCGGGCCTGACCGAAGTCACCGTGGGGCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCCGCGATCGCGGTCAACACGCAGGGCAAGG
TCTACTCCGACGCCCACTTCGTCTTCTTCAACAACAAGCAGACGCCGGACAACACGATCGTCCACACCGGTGACAACCGC
ACCGGCGAGGGCGCCGGCGACGACGAGGCGATCAACGTCAACCTGGCGGGTCTGCCGGCCGACATCGAGAAGATCGTCTT
CCCGGTCTCGATCTACGACGCCGAGAACCGCTCGCAGAACTTCGGCCAGGTGCGCAACGCCTACATCCGCATCCTCAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTGTCCGAGGACGCGGCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCTCGGGCCTGACGGGCATCGCCCAGGACTT
CGGCGTGAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTEVTVGLGWDVRTTTGTDFDLDASAIAVNTQGKVYSDAHFVFFNNKQTPDNTIVHTGDNR
TGEGAGDDEAINVNLAGLPADIEKIVFPVSIYDAENRSQNFGQVRNAYIRILNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLTGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-60 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-59 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-58 58
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCD95A.10c NP_628449.1 tellurium resistance protein BAC0390 Protein 1e-58 61
SCD95A.10c NP_628449.1 tellurium resistance protein BAC0389 Protein 1e-57 59