Gene Information

Name : SCC8A.25c (SCO2367)
Accession : NP_626614.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2536613 - 2537188 bp
Length : 576 bp
Strand : -
Note : SCC8A.25c, conserved hypothetical protein, len: 191aa; similar to proteins associated with resistance to tellurium salts e.g. SW:Q52357 (TERD_SERMA) tellurium resistance protein TerD from Serratia marcescens (192 aa) fasta scores; opt: 853, z-score: 1006.

DNA sequence :
ATGGGCGTCACGCTTGCCAAGGGCGGCAACGTCTCCCTGTCCAAGGCCGCACCGAACCTCACGCAGGTACTGGTCGGGCT
CGGCTGGGACGCGCGTTCCACCACCGGAGCACCCTTCGACCTCGACGCCAGTGCACTCGTGTGCAGCAGCGGCCGGGTGC
TCGGCGACGAGTGGTTCGTCTTCTACAACCAGCTCAAGAGCCCGGACGGCTCGATCGAGCACACCGGCGACAACCTCACG
GGCGAGGGCGACGGCGACGACGAGTCGCTGCTGGTCGACCTCTCCAAGGTGCCGGCCCACTGCGACAAGATCGTCTTCCC
GGTCTCGATCCACATGGCCGACGAGCGCGGACAGACCTTCGGCCAGGTCAGCAACGCTTTCATCCGGGTCGTCAACCAGG
CCGACGGCCAGGAGCTGGCCCGCTACGACCTCAGTGAGGACGCCTCCACGGAGACCGCGATGATCTTCGGCGAGCTCTAC
CGCTACCAGGGCGAGTGGAAGTTCCGTGCAGTGGGGCAGGGGTACGCGTCTGGGCTTCGCGGCATCGCTCTAGACTTCGG
AGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVLVGLGWDARSTTGAPFDLDASALVCSSGRVLGDEWFVFYNQLKSPDGSIEHTGDNLT
GEGDGDDESLLVDLSKVPAHCDKIVFPVSIHMADERGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGELY
RYQGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-56 67
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-60 67
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-54 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-52 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-52 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-52 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-26 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-26 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCC8A.25c NP_626614.1 hypothetical protein BAC0389 Protein 2e-56 66
SCC8A.25c NP_626614.1 hypothetical protein BAC0390 Protein 2e-56 63
SCC8A.25c NP_626614.1 hypothetical protein BAC0392 Protein 1e-25 43