Gene Information

Name : SC6G10.16 (SCO2143)
Accession : NP_626399.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2303726 - 2304391 bp
Length : 666 bp
Strand : +
Note : SC6G10.16, possible two component system response regulator, len: 221aa; similar to many eg. SW:IRLR_BURPS two component response regulator involved in heavy-metal resistance in Burkholderia pseudomallei (229 aa) fasta scores; opt: 635, z-score: 758.0, E(

DNA sequence : 
ATGAACCGCATCCTCATCGTCGAGGACGAGGAACGCATCGCCTCCTTCGTCCAGAAGGGCCTGCGCGCCAACGGCTTCAC
CACCACCGCGGTCGCCGACGGCGACGCCGCCTACGAGTACGCCCTCACCGGCGGCTTCGACCTCGTCGTCCTGGACATCG
GACTGCCCGGCCGGGACGGCTTCACGGTCCTGCGCGAGCTGCGCGAGGCCCGGGTGACGACCCCGGTGATCGTGCTGACC
GCACGGGACTCGGTACGGGACACGGTGGCCGGCCTGGAGGGCGGCGCCGACGACTGGATGACCAAGCCGTTCCGCTTCGA
GGAGCTGCTCGCCCGGGTCCGGCTGCGCCTGCGGACGGCGGCCAGGGCGCCGGAGGTGACGGTGCTGAGGTCGGGGCCGC
TCAGCCTCGACCTGCGCACCCGCCGCGCCCGGTCCGAGGGCCGCACGGTGGACCTGACGGCGCGTGAGTTCGTGCTCCTG
GAGCTGTTCCTGCGCCACCCGGGGCAGGTACTGTCCCGCGAGCAGATCCTGTCGCACGTGTGGGGCTACGACTTCGACCC
GGGCTCCAACATCGTGGACGTCTACGTGCGGGCCCTGCGCAAGAAGCTCGGCGCGCGGCAGGTGGAGACCGTGCGCGGGA
TGGGGTACCGGCTGCCGACCTGGTGA

Protein sequence : 
MNRILIVEDEERIASFVQKGLRANGFTTTAVADGDAAYEYALTGGFDLVVLDIGLPGRDGFTVLRELREARVTTPVIVLT
ARDSVRDTVAGLEGGADDWMTKPFRFEELLARVRLRLRTAARAPEVTVLRSGPLSLDLRTRRARSEGRTVDLTAREFVLL
ELFLRHPGQVLSREQILSHVWGYDFDPGSNIVDVYVRALRKKLGARQVETVRGMGYRLPTW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SC6G10.16 NP_626399.1 two component system response regulator BAC0197 Protein 9e-36 50
SC6G10.16 NP_626399.1 two component system response regulator BAC0083 Protein 2e-37 46
SC6G10.16 NP_626399.1 two component system response regulator BAC0125 Protein 2e-33 45
SC6G10.16 NP_626399.1 two component system response regulator BAC0638 Protein 1e-30 45
SC6G10.16 NP_626399.1 two component system response regulator HE999704.1.gene1528. Protein 8e-31 43
SC6G10.16 NP_626399.1 two component system response regulator BAC0308 Protein 2e-33 43
SC6G10.16 NP_626399.1 two component system response regulator BAC0347 Protein 3e-33 43
SC6G10.16 NP_626399.1 two component system response regulator BAC0111 Protein 2e-36 43
SC6G10.16 NP_626399.1 two component system response regulator AE015929.1.gene1106. Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SC6G10.16 NP_626399.1 two component system response regulator VFG1389 Protein 5e-32 46
SC6G10.16 NP_626399.1 two component system response regulator VFG0596 Protein 2e-33 44
SC6G10.16 NP_626399.1 two component system response regulator VFG1390 Protein 2e-29 41