Name : CopZ (TTE2466) Accession : NP_623992.1 Strain : Thermoanaerobacter tengcongensis MB4 Genome accession: NC_003869 Putative virulence/resistance : Resistance Product : copper chaperone Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 2356428 - 2356652 bp Length : 225 bp Strand : - Note : Best Blastp hit = gi|13702508|dbj|BAB43649.1| '(AP003137) ORFID:SA2345.; hypothetical protein, similar to mercuric ion-binding protein [Staphylococcus aureus]' gi|13874260|dbj|BAB44800.1| (AP003365) hypothetical protein [Staphylococcus aureus], score 73.9 DNA sequence : ATGGGTTTGTTTGGACCTAAGGGTGAGACTATCGTCATAAATGTTAAGGGGATGACATGCAACCATTGCAAAATGTCTGT TGAAAATGCACTAAAGAAGTTAAATGGGGTATTGAAAGCTGTTGTTGACCTTGATAAAGGTAATGTTACGGTAACATATG ACCCTGCTAAAGTTTCTGTCGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA Protein sequence : MGLFGPKGETIVINVKGMTCNHCKMSVENALKKLNGVLKAVVDLDKGNVTVTYDPAKVSVDDMKKAIIDTGYEV |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 9e-10 | 44 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-09 | 44 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-09 | 44 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-09 | 43 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-09 | 43 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-09 | 43 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 3e-09 | 43 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-09 | 43 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-09 | 43 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
CopZ | NP_623992.1 | copper chaperone | BAC0634 | Protein | 3e-07 | 44 |
CopZ | NP_623992.1 | copper chaperone | BAC0679 | Protein | 1e-08 | 41 |