Gene Information

Name : FN0585 (FN0585)
Accession : NP_603482.1
Strain : Fusobacterium nucleatum ATCC 25586
Genome accession: NC_003454
Putative virulence/resistance : Virulence
Product : two-component response regulator CzcR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1239928 - 1240602 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATTTTAGTAGTTGAAGATGAAAAAGACTTAAATAATATAATCAGTAAACATTTAAAGAAAAATAATTTTAGTGT
TGATAGTGTTTTTGATGGAGAAGAAGCACTTGAATATCTAAGCTATGGTGATTATGATGTAATAATATTAGATGTAATGA
TGCCTAAAATGAATGGTTATGAAGTAGTTAAAAATCTTAGAGCAAATAAAAATGAAACAGCAGTTTTAATGTTGACAGCA
AGAGATGGAATAGATGAAAAGATAAAAGGTTTAGATTTAGGAGCAGATGATTATTTAGTTAAACCCTTTGACTTTAGAGA
ACTTATAGCAAGAATTAGAGCTCTTGTGAGAAGAAAATATGGAAATATTTCAAATGAATTACAAATAGATGATTTAATAG
TTGATACTTCAAAAAAATCTGTTACAAGAGCAGGAAAAAATATAGAATTAACAGGAAAAGAATATGAGGTATTAGAATAT
TTAATTCAAAATAAAGGTCGTGTGTTAAGTAGAGATAAAATTAGAGATGGTGTGTGGGACTATGCTTATGAAGGAGAATC
AAATATTATAGATGTTTTAATAAAAAATATTCGTAAAAAAATTGATTTAGGAGATTCAAAACCATTAATACACACAAAAA
GAGGTTTAGGCTATGTTCTTAAAGAAGATGAATAG

Protein sequence :
MKILVVEDEKDLNNIISKHLKKNNFSVDSVFDGEEALEYLSYGDYDVIILDVMMPKMNGYEVVKNLRANKNETAVLMLTA
RDGIDEKIKGLDLGADDYLVKPFDFRELIARIRALVRRKYGNISNELQIDDLIVDTSKKSVTRAGKNIELTGKEYEVLEY
LIQNKGRVLSRDKIRDGVWDYAYEGESNIIDVLIKNIRKKIDLGDSKPLIHTKRGLGYVLKEDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 8e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FN0585 NP_603482.1 two-component response regulator CzcR BAC0083 Protein 6e-49 47
FN0585 NP_603482.1 two-component response regulator CzcR BAC0308 Protein 5e-46 46
FN0585 NP_603482.1 two-component response regulator CzcR BAC0125 Protein 1e-44 45
FN0585 NP_603482.1 two-component response regulator CzcR BAC0111 Protein 1e-46 45
FN0585 NP_603482.1 two-component response regulator CzcR BAC0197 Protein 6e-43 45
FN0585 NP_603482.1 two-component response regulator CzcR BAC0347 Protein 5e-41 43
FN0585 NP_603482.1 two-component response regulator CzcR BAC0638 Protein 2e-41 43
FN0585 NP_603482.1 two-component response regulator CzcR NC_002952.2859905.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_009782.5559369.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_002951.3237708.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_002758.1121668.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_009641.5332272.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_013450.8614421.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_007793.3914279.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_007622.3794472.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR NC_002745.1124361.p0 Protein 3e-40 42
FN0585 NP_603482.1 two-component response regulator CzcR AE015929.1.gene1106. Protein 1e-31 41
FN0585 NP_603482.1 two-component response regulator CzcR CP000675.2.gene1535. Protein 1e-36 41
FN0585 NP_603482.1 two-component response regulator CzcR NC_003923.1003749.p0 Protein 4e-40 41
FN0585 NP_603482.1 two-component response regulator CzcR HE999704.1.gene2815. Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FN0585 NP_603482.1 two-component response regulator CzcR VFG1390 Protein 1e-44 41
FN0585 NP_603482.1 two-component response regulator CzcR VFG1386 Protein 6e-40 41