
|
Name : merP (HCM1.233c) Accession : NP_569423.1 Strain : Genome accession: NC_003384 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 174179 - 174454 bp Length : 276 bp Strand : - Note : similar to (EMBL:J01730) merP from Shigella flexneri plasmid IncFII NR1 DNA sequence : ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGCTGTTGCCCCGGTGTGGGCCGCTACCCAGACCGTCACGCTAGC GGTTCCCGGCATGACTTGCGTCGCCTGCCCGATCACAGTCAAGAAAGCGCTCTCCAAGGTCGAAGGCGTGAGCAAGGTCG ATGTGGGCTTCGAGAAGCGCGAGGCCGTCGTCACTTTTGACGACACCAAGGCCAGCGTACAGAAGCTGACCAAGGCCACC GCAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA Protein sequence : MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCVACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT ADAGYPSSVKQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-24 | 99 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-24 | 99 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-24 | 99 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-24 | 99 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-24 | 99 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-24 | 99 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-21 | 79 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-21 | 79 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 9e-22 | 79 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| merP | NP_569423.1 | mercuric transport protein periplasmic binding protein | BAC0678 | Protein | 1e-22 | 88 |
| merP | NP_569423.1 | mercuric transport protein periplasmic binding protein | BAC0679 | Protein | 2e-22 | 87 |
| merP | NP_569423.1 | mercuric transport protein periplasmic binding protein | BAC0231 | Protein | 8e-22 | 85 |
| merP | NP_569423.1 | mercuric transport protein periplasmic binding protein | BAC0675 | Protein | 9e-19 | 69 |
| merP | NP_569423.1 | mercuric transport protein periplasmic binding protein | BAC0674 | Protein | 2e-15 | 60 |